KEGG   Thermococcus gammatolerans: TGAM_0261Help
Entry
TGAM_0261         CDS       T00920                                 

Gene name
porB
Definition
(GenBank) Pyruvate synthase subunit porB (pyruvate oxidoreductase beta chain) (pyruvate ferredoxin oxidoreductase) (porB)
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
tga  Thermococcus gammatolerans
Pathway
tga00010  Glycolysis / Gluconeogenesis
tga00020  Citrate cycle (TCA cycle)
tga00620  Pyruvate metabolism
tga00633  Nitrotoluene degradation
tga00640  Propanoate metabolism
tga00650  Butanoate metabolism
tga00680  Methane metabolism
tga00720  Carbon fixation pathways in prokaryotes
tga01100  Metabolic pathways
tga01120  Microbial metabolism in diverse environments
tga01130  Biosynthesis of antibiotics
tga01200  Carbon metabolism
Module
tga_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TGAM_0261 (porB)
   00020 Citrate cycle (TCA cycle)
    TGAM_0261 (porB)
   00620 Pyruvate metabolism
    TGAM_0261 (porB)
   00640 Propanoate metabolism
    TGAM_0261 (porB)
   00650 Butanoate metabolism
    TGAM_0261 (porB)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TGAM_0261 (porB)
   00680 Methane metabolism
    TGAM_0261 (porB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TGAM_0261 (porB)
Enzymes [BR:tga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TGAM_0261 (porB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: ACS32763
UniProt: C5A3F1
Position
complement(247723..248727)
Genome map
AA seq 334 aa AA seqDB search
MMKMAVRKPPITTREYWAPGHAACAGCGCAIALKLATKAFSEAMEEKYGDPNAFAIAQAT
GCMEVVSAVFPYTAWKVPWVHVAFENAAAAASGIEAAWKKKGLKGKILAIGGDGGTADIG
LQALSGMLERRHNVVYLMYDNEAYMNTGIQRSSSTPYGAWTTTSPPGKYSIGEDKPKKWV
ALIAAAHQVPYVATASIGNPFDFVRKMKKAAKVDGPAFVQVHCTCPTGWKSPLEKGVEIA
RLAIETGIWPLFEIENGDFHNIKIQSPGGGAKVKREGGKVVAIEFKKPIEEYLKLQGRFK
HLFKRPEAIDQLREQIKAMWKVLGVEVTLPKPEE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaagatggccgttaggaagccccctatcacaactcgcgagtactgggcgcccggt
cacgccgcgtgtgccggctgtggctgtgcaatcgctcttaagctcgccacaaaggccttc
agcgaggctatggaggaaaagtacggcgacccgaacgccttcgccatagcccaggccacg
ggatgtatggaggtcgtttcggcggtcttcccctacaccgcctggaaggttccatgggtg
cacgtagcctttgagaacgcggccgccgccgcgagcggtattgaggccgcctggaagaag
aagggactcaagggcaagatacttgccataggcggtgacggtggtaccgccgacataggc
cttcaggccctcagcggtatgctcgagaggagacacaacgtcgtttacctgatgtacgac
aacgaggcctacatgaacacgggaattcagcgctcaagctctaccccctacggagcctgg
acgaccacctcacctcccggcaagtactccatcggtgaggacaagcccaagaagtgggtc
gccctcattgctgcggcccaccaggttccatacgtcgccaccgcgagcataggcaacccc
ttcgacttcgtcaggaagatgaagaaggccgctaaggtcgacggcccggccttcgtccag
gttcactgtacttgcccgaccggatggaagagcccgctcgagaagggcgttgaaatagct
aggctcgccatcgagactggaatatggccactcttcgagatcgagaacggcgacttccac
aacatcaagatacagagcccaggaggaggcgcgaaggtcaagcgcgagggaggcaaagta
gttgccatcgagttcaagaaacccatagaggagtaccttaagttgcagggcaggttcaag
cacctcttcaagaggccagaggcaatcgaccagctccgcgagcagataaaggccatgtgg
aaggtcctcggcgtcgaggtcacgcttccaaagccggaggagtga

DBGET integrated database retrieval system