KEGG   Thermococcus gammatolerans: TGAM_0263Help
Entry
TGAM_0263         CDS       T00920                                 

Gene name
porD
Definition
pyuvate ferredoxin oxidoreductase subunit delta (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
tga  Thermococcus gammatolerans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TGAM_0263 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TGAM_0263 (porD)
   00020 Citrate cycle (TCA cycle)
    TGAM_0263 (porD)
   00620 Pyruvate metabolism
    TGAM_0263 (porD)
   00640 Propanoate metabolism
    TGAM_0263 (porD)
   00650 Butanoate metabolism
    TGAM_0263 (porD)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TGAM_0263 (porD)
   00680 Methane metabolism
    TGAM_0263 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TGAM_0263 (porD)
Enzymes [BR:tga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TGAM_0263 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(249925..250242)
Genome map
AA seq 105 aa AA seqDB search
MAESPFKADIERVQKEYSEKMTPGAIAYIPGSSVINKTGSWRVFMPEFYRDKCVRCYLCY
IYCPEPAIYLDEENYPVFDYDYCKGCGICANECPTDAIVMVRESK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggctgagagcccgtttaaggccgacattgagagggttcagaaggagtatagcgaaaag
atgactccgggagctattgcctacatcccggggagtagcgtaatcaacaagaccggctcg
tggagagtcttcatgcccgagttctacagggacaagtgcgttcgctgctacctctgctac
atctactgccccgagcctgccatctacctcgacgaggagaactacccggtcttcgactac
gactactgtaagggttgtggaatctgcgcgaacgagtgcccgaccgatgctatagttatg
gttagggagagcaagtga

DBGET integrated database retrieval system