KEGG   Thermococcus gammatolerans: TGAM_0264Help
Entry
TGAM_0264         CDS       T00920                                 

Gene name
vorB
Definition
2-ketoisovalerate ferredoxin oxidoreductase subunit beta (EC:1.2.7.7)
Orthology
K00187  
2-oxoisovalerate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.7]
Organism
tga  Thermococcus gammatolerans
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:tga00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(250292..251227)
Genome map
AA seq 311 aa AA seqDB search
MEIPESIKKRLTIPAEEHFFAGHTACQGCGASLGLRYVLKAYGKKTIVVIPACCSTIIAG
AWPYNTLDANLFHTAFETTGAVISGIEAALKARGIKVKGEDGVMVVGWAGDGGTADIGLQ
ALSGFLERGHDAVYIMYDNEAYMNTGIQRSSSTPYGAWTTNTPGGKMHFLEKRHKKKVID
IVIAHEVPYAATASVAFPEDFIRKLKKARKIPGPSFIQLFSPCPTGWRSPTDKSIEIARL
AVQTAYFPLFEYENGKYKINMPSPKKEPKPIEEFLKLQGRFKYMTREDIENLQAWVLREW
EKLKKLAEVFG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggagatccccgagagcattaagaaaaggttgaccattcccgctgaggagcacttcttt
gccggccacaccgcctgtcagggttgcggtgcttcactcggactgcgttacgtcctcaag
gcttacggcaaaaagacgattgttgtcatccccgcgtgctgttcaaccatcatagccggg
gcgtggccctacaacaccctcgacgccaacctcttccacaccgcctttgagacgactgga
gccgtcataagcggtatcgaggccgctctgaaggcgaggggaataaaggtcaagggcgaa
gatggggtaatggtcgtcggctgggccggcgacggtggtaccgccgacataggccttcag
gctttgagcggattccttgagaggggccacgacgccgtttacataatgtacgacaacgag
gcctacatgaacacgggaattcagcgctcaagctctaccccctacggagcctggacgacg
aacacccctggaggaaagatgcacttcctcgagaagaggcacaagaagaaggtcatcgac
atcgtcatagcgcacgaggttccctacgctgcgaccgcgagcgttgcgtttccagaggac
ttcataaggaagctcaagaaggccagaaagataccgggaccgagcttcatccagctcttt
agcccgtgcccgacgggctggcgctcgccgaccgacaagagcatcgagatagcaaggctc
gccgttcagacggcttacttcccgctcttcgagtacgagaacgggaagtacaagatcaac
atgccctcacccaagaaggagccgaagccgattgaggagttcctcaagctccagggtcgc
tttaagtacatgaccagggaggacatcgagaacctccaagcctgggtgctccgcgaatgg
gagaagctgaagaagctcgccgaggtgttcggctga

DBGET integrated database retrieval system