KEGG   Thermococcus gammatolerans: TGAM_0264Help
Entry
TGAM_0264         CDS       T00920                                 

Gene name
vorB
Definition
2-ketoisovalerate ferredoxin oxidoreductase subunit beta (EC:1.2.7.7)
Orthology
K00187  
2-oxoisovalerate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.7]
Organism
tga  Thermococcus gammatolerans
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TGAM_0264 (vorB)
Enzymes [BR:tga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)
     TGAM_0264 (vorB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(250292..251227)
Genome map
AA seq 311 aa AA seqDB search
MEIPESIKKRLTIPAEEHFFAGHTACQGCGASLGLRYVLKAYGKKTIVVIPACCSTIIAG
AWPYNTLDANLFHTAFETTGAVISGIEAALKARGIKVKGEDGVMVVGWAGDGGTADIGLQ
ALSGFLERGHDAVYIMYDNEAYMNTGIQRSSSTPYGAWTTNTPGGKMHFLEKRHKKKVID
IVIAHEVPYAATASVAFPEDFIRKLKKARKIPGPSFIQLFSPCPTGWRSPTDKSIEIARL
AVQTAYFPLFEYENGKYKINMPSPKKEPKPIEEFLKLQGRFKYMTREDIENLQAWVLREW
EKLKKLAEVFG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggagatccccgagagcattaagaaaaggttgaccattcccgctgaggagcacttcttt
gccggccacaccgcctgtcagggttgcggtgcttcactcggactgcgttacgtcctcaag
gcttacggcaaaaagacgattgttgtcatccccgcgtgctgttcaaccatcatagccggg
gcgtggccctacaacaccctcgacgccaacctcttccacaccgcctttgagacgactgga
gccgtcataagcggtatcgaggccgctctgaaggcgaggggaataaaggtcaagggcgaa
gatggggtaatggtcgtcggctgggccggcgacggtggtaccgccgacataggccttcag
gctttgagcggattccttgagaggggccacgacgccgtttacataatgtacgacaacgag
gcctacatgaacacgggaattcagcgctcaagctctaccccctacggagcctggacgacg
aacacccctggaggaaagatgcacttcctcgagaagaggcacaagaagaaggtcatcgac
atcgtcatagcgcacgaggttccctacgctgcgaccgcgagcgttgcgtttccagaggac
ttcataaggaagctcaagaaggccagaaagataccgggaccgagcttcatccagctcttt
agcccgtgcccgacgggctggcgctcgccgaccgacaagagcatcgagatagcaaggctc
gccgttcagacggcttacttcccgctcttcgagtacgagaacgggaagtacaagatcaac
atgccctcacccaagaaggagccgaagccgattgaggagttcctcaagctccagggtcgc
tttaagtacatgaccagggaggacatcgagaacctccaagcctgggtgctccgcgaatgg
gagaagctgaagaagctcgccgaggtgttcggctga

DBGET integrated database retrieval system