KEGG   Thermococcus gammatolerans: TGAM_0276Help
Entry
TGAM_0276         CDS       T00920                                 

Definition
Histone acetyltransferase-like protein (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
tga  Thermococcus gammatolerans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
261308..263077
Genome map
AA seq 589 aa AA seqDB search
MEEFEKAVNELARLVMSGEIKSRDELNRWKIKVARKYHLSKIPGNSDILKAIPEERREEF
RELLKRKPTRTISGVAVVAMMTKPFPCPHGRCIYCPGGPSVGSPQSYTGREPSALRAIQS
AYHPYIIMMRRLKQLTDIGHDVDKVEVIIQGGTFPAVDLDYQEWFVKCAFKAMNDFPYFK
DIENLEEKLIRLIVKKDESVFEEDPKFREAWQKTHSKPYYYLEDEQRKNEKAKVRMVGLT
IETRPDWAFERHIDRMLKLGTTRVELGVQTIFNFIHERTKRGHGVEEIVKATQLLRDAGL
KINYHIMPGLPGSNFERDLYTFRTIFEDPRFRPDMLKIYPTLVTKDAPLYRWWKEGKYRP
YRTEEAVELLVEAYKLFPKWVRVMRIQRDIPVQLIVDGVKHSNLGQLVFNELIKRGIRPR
EIRFREVGHMMEKFGIQPEVEHIKLLREDYDAAGGREIFLSFEDVKNDILIGFLRLRIPS
ENAHRKEINCCPSAIVRELHVYGPLVPIGGKPRYEWQHRGYGRELLAEAERIAREEFEVK
KMLVISGVGVREYYRKFGYRKNGPYVAKRLDKGYAEYKKSREFDAHLNT
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggaggagtttgaaaaggccgttaacgagctggcgagactggtcatgagcggtgagatt
aagagccgggacgagctcaaccgctggaagattaaggtggcgagaaagtatcacctctca
aagattccgggcaactcggacattcttaaggccattccagaggagaggcgcgaggagttc
agggaactgctcaagagaaagccaacccgaactataagcggcgtcgccgtcgtcgccatg
atgacgaagccatttccctgccctcatggcagatgcatctactgtcccggtgggccgagc
gtcggttcacctcaaagctacactggaagggagccttccgccctgagggcaatccagagc
gcttatcatccctacatcatcatgatgcgcaggttaaagcaactcaccgatatcggccac
gacgttgacaaggtcgaggtcataatccagggcggaacgtttccggcggttgacctggat
taccaggagtggttcgtcaagtgcgccttcaaggctatgaacgactttccgtatttcaag
gacattgagaacctcgaggagaagctgattaggctgatagtgaagaaggacgagtccgtt
tttgaggaggaccctaagttccgtgaggcttggcagaaaacccactcgaagccctactac
taccttgaagacgagcagaggaagaacgagaaagctaaggtcagaatggtcggcctaacc
atagagacccgcccggactgggccttcgagaggcacatagacaggatgctcaagctggga
accacgcgcgttgagctgggcgtccagacgatattcaacttcatccacgagagaactaag
agaggtcacggcgtcgaggagatagtaaaggccactcaacttttgagagacgctgggttg
aaaatcaactaccacataatgcccggtctgcctgggagcaactttgagagagatttgtac
accttccgcacaatattcgaagacccccgcttcaggcccgatatgctgaaaatctatccg
acgctcgtaaccaaggacgccccgctctaccgctggtggaaggaaggtaaataccgcccc
taccgcacggaggaagccgttgaactcctcgtcgaggcctacaagctcttcccgaagtgg
gttagggtaatgagaatccagcgcgacattccggttcagctcatcgttgatggcgttaag
cactccaacctcggtcagctggtcttcaacgagctgataaagcgcggtataaggccgagg
gagattcgctttagggaagtcggccacatgatggagaagttcggaatccagcccgaggtc
gagcacatcaagctcctccgcgaggactacgatgccgctggcggaagggagatattcctc
agcttcgaggacgtcaagaacgacatcctaatcggcttcctcaggcttagaattccgagc
gagaatgcccacaggaaggagataaactgctgtccctcagccatagtcagggagctccac
gtttacggcccgctcgtgccgattggaggaaagccacgctatgagtggcagcatcgcgga
tacggaagggagctcttggccgaggccgagagaattgctcgggaggagttcgaggttaag
aagatgctcgttatcagcggtgtcggcgtgagggagtattacagaaagttcggctaccgg
aagaacgggccctacgtcgcgaagaggcttgataagggctatgcagagtataaaaagagc
agggagttcgacgcgcacctgaacacttag

DBGET integrated database retrieval system