KEGG   Thermococcus gammatolerans: TGAM_0313Help
Entry
TGAM_0313         CDS       T00920                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tga  Thermococcus gammatolerans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TGAM_0313 (tpiA)
   01230 Biosynthesis of amino acids
    TGAM_0313 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TGAM_0313 (tpiA)
   00051 Fructose and mannose metabolism
    TGAM_0313 (tpiA)
   00562 Inositol phosphate metabolism
    TGAM_0313 (tpiA)
Enzymes [BR:tga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TGAM_0313 (tpiA)
Exosome [BR:tga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TGAM_0313 (tpiA)
  Exosomal proteins of bladder cancer cells
   TGAM_0313 (tpiA)
  Exosomal proteins of melanoma cells
   TGAM_0313 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
298241..298921
Genome map
AA seq 226 aa AA seqDB search
MTKLKEPIIAINFKTYIEATGKRALAIAKAAEKVYKETGITIVVAPQLADLRMVAESVEI
PVFAQHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEASIRRAEEVGLMT
MVCSNNPAVSAAVAALGPDYVAVEPPELIGTGIPVSKAKPEVITDTVELVKKVNPEVKVL
TGAGISTGEDVKKALELGSVGVLLASGVTKAKDPEKAIRDLVSLII
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagctgaaggaacctattatagcgattaacttcaagacctacatcgaggcaacc
ggaaagagagctttggcaatagcgaaggccgctgaaaaggtctacaaagagacggggata
accatagtcgtcgcgccccagctcgccgacctcaggatggtagcggagagcgttgagatc
ccggtcttcgcccagcacatagacccgattaagcccggaagccacaccggtcacgtcctt
cccgaggcagttaaggaagccggggccgttggaaccctcctcaaccactccgagaacagg
atgatcttggcggaccttgaggcgagcattagaagagccgaagaagttggacttatgacg
atggtctgctccaacaatccagccgtttcggctgcggtggcagctctcggcccagactac
gttgccgtcgaaccgccagaacttataggcaccggcatccccgtcagcaaggccaagccg
gaggtcataactgatacagttgagctcgtcaagaaagttaaccctgaggttaaagtcctc
actggtgcaggaataagcactggcgaggatgtcaagaaggcccttgagctcggaagcgtt
ggagttctgcttgcaagcggtgttaccaaagctaaggatcccgagaaggcaataagggac
ttggtgtccctcatcatctga

DBGET integrated database retrieval system