KEGG   Thermococcus gammatolerans: TGAM_0734Help
Entry
TGAM_0734         CDS       T00920                                 

Gene name
aor-1
Definition
Tungsten-containing aldehyde ferredoxin oxidoreductase, N-terminal fragment (aor) (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tga  Thermococcus gammatolerans
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TGAM_0734 (aor-1)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TGAM_0734 (aor-1)
Enzymes [BR:tga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TGAM_0734 (aor-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
695495..696892
Genome map
AA seq 465 aa AA seqDB search
MFTYHNRIARVNLTEGTVTYEELPDEVIRKFIGGKGLGYYLIYWEVPPGTDPLSPANKFV
FATGGLTGLIPGSSKVIAVSKSPETRLISDSSGGDAFGPKLKGHFDALIIEGKAEEPVYL
YVHDGEVEIRNAEHLWGRGNYEVAKELWREHPKASLALIGPAGERLSRIANVIYDTERAS
GRGGLGAVLGSKKVKAIVVEPGEKPPVANPEEFQKLWQEFYEHFATDPKYEHSRKYGTSD
GLRSSASLGMSPAYNFSRPYIPDELASKLGGDEVKKYEVEPEWFVHGKSCPIKCARYVEV
EYRGRRIRVKPEYESIAMLGAATGVFNFPAVAYFNWLVNNLGLDSIATGNTIAWFFELVE
RGLISEEEIGFPVKGFGDEEAEERLIRLMAERKGIGAILADGVKRACERLGRGCEFAVHV
KGMESPAWDPRGRRTYALSYATADVGASHLRGWPRPHQLPEPGTR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgttcacttaccacaacaggatagcgagggtgaacctgaccgagggaacggtcacctac
gaggaactgcccgacgaggtgataaggaagttcatcggcggaaagggactcggatactat
ctgatttattgggaggttccaccgggaaccgacccgctcagcccggccaacaagttcgta
tttgcaactggcggtttgaccgggttaattccgggttcgagcaaggtcatagcggtcagc
aagagccccgaaaccagattaatcagcgattccagcggtggagacgccttcggacccaag
ctcaagggccacttcgatgcgctcattatcgaagggaaagccgaggagcccgtctacctt
tacgtccacgatggggaggtggaaatcaggaatgcagagcacctgtggggcaggggcaac
tatgaagtggccaaagaactctggagggagcacccgaaggcgagcttggctttaattggc
ccggccggcgagaggctcagcaggattgccaacgtgatttacgacaccgagcgcgcgagc
gggaggggcggtcttggagccgtcctcggaagcaagaaggttaaagcaattgtagttgag
cccggggagaagccaccggttgccaacccggaggagttccagaaactgtggcaggagttc
tacgagcacttcgcgaccgacccaaagtacgagcacagcagaaaatacgggacgagcgat
gggctgagaagctcggcctccctcggcatgagcccggcctacaacttctcaaggccctac
attcccgatgagcttgccagcaaactcgggggtgatgaggtcaagaagtacgaggttgaa
ccggagtggttcgtccacggcaagagctgtccgattaagtgcgcccgctacgtagaggtc
gagtataggggcaggagaatccgcgtcaagccggaatacgagagcatcgcgatgctcgga
gcggcgactggagtattcaactttcctgccgttgcctacttcaactggctcgtcaacaac
ctcggcctcgacagcatagcgacgggcaacacaatagcctggttcttcgagctggtcgag
aggggtctcataagcgaggaggagataggcttccctgtcaagggcttcggcgacgaggag
gcggaggagaggctcatcaggctgatggccgagaggaagggaatcggagcgattttagcg
gacggcgtaaagagggcctgtgagaggctcggcaggggttgcgagttcgcggtgcacgtg
aagggcatggaaagtccagcttgggacccccgcgggaggagaacctacgcgctcagctac
gccaccgctgacgttggagcgagccatttaaggggctggccaagaccccatcagctaccc
gaaccagggacccgctaa

DBGET integrated database retrieval system