KEGG   Thermococcus gammatolerans: TGAM_0813Help
Entry
TGAM_0813         CDS       T00920                                 

Gene name
pgm
Definition
phosphoglucomutase (pgm) (EC:5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tga  Thermococcus gammatolerans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TGAM_0813 (pgm)
   00030 Pentose phosphate pathway
    TGAM_0813 (pgm)
   00051 Fructose and mannose metabolism
    TGAM_0813 (pgm)
   00052 Galactose metabolism
    TGAM_0813 (pgm)
   00500 Starch and sucrose metabolism
    TGAM_0813 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    TGAM_0813 (pgm)
  Nucleotide metabolism
   00230 Purine metabolism
    TGAM_0813 (pgm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TGAM_0813 (pgm)
Enzymes [BR:tga01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     TGAM_0813 (pgm)
    5.4.2.8  phosphomannomutase
     TGAM_0813 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(764638..766026)
Genome map
AA seq 462 aa AA seqDB search
MVDMGRLFGTFGVRGIANEKITPEFALKMGMAFGTMLKREGREKPLVVVGRDTRVSGEML
KSALISGLLSVGCDVIDVGIAPTPAIQWATSHFKADGGAVITASHNPPEYNGIKLLEPNG
MGLKKEREAVVEEVFFKEDFDRAKWDEIGEVREEDIIKPYIEAIKSRVDVEAIRKRRPFV
VVDTSNGAGSLTLPYLLRELGCKVVSVNAHPDGHFPARNPEPNEENLKDFMKIVKALGAD
FGVAQDGDADRAVFIDENGRFIQGDKTFALVADAVLRENGGGLLVTTIATSNLLDDIAKR
NNARVMRTKVGDLIVARALLEHNGTIGGEENGGVIFPDFVLGRDGAMTTAKIVEIFAKSG
KKFSELIDELPKYYQFKTKRHVEGDRKAIVAKVAELARERGYEIDTTDGTKILFPDGWVL
VRASGTEPIIRVFSEARSEEKAKEYLELGLELLSISTREASG
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtggtggacatgggaaggctcttcggaaccttcggtgttcgtgggatagccaacgagaag
ataaccccggagttcgcgctcaagatgggcatggccttcgggacgatgctcaagcgcgag
ggaagggaaaaacctctagtggtagtcggcagggacacgagggtgagcggtgagatgctg
aagagcgccctcatcagcggtctcctcagcgtcggctgtgacgtcatcgacgttggaatc
gcgccgacccctgcaatacagtgggccaccagccacttcaaggccgacggaggagcggtt
ataaccgcttcacacaacccgcccgaatacaacggcataaagctccttgaacccaacggt
atgggcctcaagaaggagcgcgaagcggtcgtggaggaggtcttctttaaggaggacttc
gacagggcgaagtgggacgaaatcggcgaggttcgcgaagaggacatcatcaagccctac
atcgaggcgataaagagcagggtggatgttgaagcaatcaggaaaagacggcccttcgtc
gtcgttgacacatcaaacggcgctggtagtctgactctgccctacttgctcagggagctc
ggctgtaaagtcgtcagcgtcaacgcccacccggacggtcacttcccggcaaggaacccc
gagccaaacgaggagaaccttaaggacttcatgaagatcgtgaaggccctcggtgccgac
ttcggcgttgcccaggacggcgacgcggacagggcagttttcatagacgagaacggacgc
ttcattcagggcgacaagacgttcgcgctcgttgccgacgcggttctcagggaaaacggt
ggtgggctgctcgtgaccacgatagcgacctcgaacctgctcgatgacatcgcgaagagg
aacaacgctagggttatgcgcacgaaggttggagatttaatcgttgcccgcgcgctcctc
gagcacaacggaaccatcggcggcgaggagaacggtggagtcatcttcccggacttcgtc
ctcgggagagacggggcgatgaccaccgcaaagatagtcgagattttcgcgaagagcgga
aagaagttcagcgagctgattgatgagctaccgaagtactaccagttcaagacgaagagg
cacgtagaaggcgatagaaaggcgatcgtggcaaaggtagcggagcttgcaagggagagg
ggttacgagatagacaccaccgacgggactaagatactcttcccggacggctgggttctc
gtgagggcgagcggaaccgagccgataataagggtcttcagcgaggccaggagcgaggag
aaggcaaaggagtaccttgagctggggcttgagcttcttagtatctccactcgcgaggcc
tctggctaa

DBGET integrated database retrieval system