KEGG   Thermococcus gammatolerans: TGAM_0861Help
Entry
TGAM_0861         CDS       T00920                                 

Definition
M42 family glutamyl aminopeptidase, de-blocking aminopeptidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tga  Thermococcus gammatolerans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TGAM_0861
Enzymes [BR:tga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     TGAM_0861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(805942..806979)
Genome map
AA seq 345 aa AA seqDB search
MVNLELLKKIVEAPGVSGYEFLGIRDVVMEELKPYVDEIKVDKLGNVIAHKKGSGPKIMI
AAHMDKIGVMVNHIDKEGYLHIVPVGGVDPRTLVAQRIRFFTEKGERFGVVGHIPPHLQK
PEDRKKAANWDTIVVDVGAEGKEEAEEMGFRVGTVGEFAPAFTQLNENRIATPYLDDRVC
LYAMIEAAKAVENHEADIYFVASVQEEVGLRGARVASYAIDPEIGIAMDVTFAKQVGDKG
KIVPKLGGGPVMDVGPNINPKVRAFADEVAKKYNIPLQVEASPRPTGTDANIMQINREGV
ATAVLSIPIRYMHSQVETADLRDIDKTIEFAKHFLEELRPMNLIP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacctcgaactgctcaagaagatcgttgaggcccccggcgtttctggctatgag
ttcctcggaataagggacgtcgttatggaggagctcaagccctatgtcgacgagatcaaa
gtggacaagctcggaaacgttatagctcacaagaagggcagcgggccaaagatcatgatc
gccgcccacatggacaagataggtgtcatggtcaaccacatagacaaggagggctacctt
cacatcgttccagtcggtggcgttgaccccagaaccctcgttgcccagaggataaggttt
ttcacagagaagggtgagaggtttggggttgtcggccacatacccccccaccttcagaaa
cccgaggacagaaagaaagcggcgaactgggacaccatcgttgtggatgttggcgctgag
ggcaaggaagaagcagaggagatgggtttccgcgttggaaccgttggcgagttcgctccg
gcttttactcagctaaacgagaacaggattgcaacgccatatctcgacgaccgcgtttgc
ctctacgccatgatagaggccgccaaggccgttgagaaccacgaggcagacatctacttc
gtcgcctccgtgcaggaggaggtcggtttgaggggtgctagagttgccagctatgccatc
gatcccgagataggcattgcgatggacgtcacctttgccaagcaggtcggcgacaagggc
aagattgtgcccaagctcggtgggggcccggtcatggacgtcggcccaaacatcaacccc
aaggttcgtgcctttgccgacgaggttgcaaagaagtacaacatcccactccaggtggag
gcatctccaagaccgacaggaaccgacgccaacataatgcagatcaacagggagggcgtt
gcaactgctgtcctcagcataccgatacgctacatgcacagtcaggtcgaaactgccgac
ctgagggacatcgacaagaccatcgagtttgccaagcacttccttgaggaactcaggcca
atgaacctcatcccgtga

DBGET integrated database retrieval system