KEGG   Thermococcus gammatolerans: TGAM_1026Help
Entry
TGAM_1026         CDS       T00920                                 

Gene name
glpK-1
Definition
glycerol kinase (glpK) (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tga  Thermococcus gammatolerans
Pathway
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
977795..979291
Genome map
AA seq 498 aa AA seqDB search
MSYYLILDVGTTNVKAYAFSEEGEVLLKKSMRTRPVYPEPGWAELDPEELIETVRRLIDG
VTSSLGMPKGMAITNQRSSTVVWDDEGALHNMITWQDTRTKDIVEAFSRNFLVRFGRALG
KVFYGLSRIVPGIASLPKGAYIITLAHVGFGTSHSSMHLRWLMDNVPEVRKAVEDGTAKF
GTMDSWIAWNLTGKHVTDYTNASATGLFDPFYLKWSDNIMGIVGIPKKILPALQPNDLPV
GETDYGVPLLTMVADQQAALYRAGVEPGSAKMTHGTGTFIDLNVGEKPKPASPGLYPMVA
LKTRKKTLYLLEGIINASGSAVDWLLSVGLIKDYSEISAAFKDPTLPRVLFIPAFAGLST
PYLKPEFRGALLNLSFSVRKEDIIKALIAGIAMRVAEVIAAMESGTGVEIGSLTSDGGAS
QIDPLLQLIADFSGKRIVRPVELNGSAQGTFMIARAVAEGSDVLSAWEKPMVERVFEPSG
EKHEDFRRLWEEFMGRLL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagttactacctcatcctggacgttgggactacgaacgtcaaggcctacgctttttcc
gaggagggggaggtgctcctgaagaagagcatgagaacacggcccgtttatccggagcct
ggctgggccgaactcgaccccgaagagctcattgaaacggtcaggcggctcatagacggg
gttacctcttcccttgggatgccaaagggaatggccatcaccaaccagcggagctccacc
gtcgtgtgggacgacgaaggagcgctccacaacatgataacctggcaggacacgaggacc
aaagatatcgtggaggccttttcccgcaacttcctcgttcgctttggtagggctctcgga
aaggtcttctacggactctcccgcatcgttcccggaatagccagcctaccaaagggagcc
tatataatcaccctggcccacgtgggcttcggcacttcccactcctcgatgcacctacgc
tggctaatggacaacgtgccagaagtcaggaaggccgtcgaggatggaactgcgaagttc
ggcacgatggacagctggatagcgtggaacctgacggggaagcatgtgacggactacacg
aacgcatccgcgacgggcctctttgacccgttctacctcaagtggagcgacaacatcatg
ggcatcgtgggaattcccaagaaaattcttcccgccctccagccgaacgacctcccagtg
ggggaaacggactacggtgtgcccctcctcacgatggtggcggatcagcaggcggccctt
taccgtgcgggtgttgagccggggagcgcgaagatgacccacggaacggggacgttcatt
gacctgaacgtaggcgagaagccgaagccagcgtcgccaggcctctacccgatggtcgcc
cttaaaaccaggaaaaagacgctctacctcctcgagggaataataaacgcctccggctcg
gccgttgactggctcctgagcgttggcctcatcaaggactactctgagatcagcgctgcg
tttaaagatcccacccttccaagggtgctcttcatacccgccttcgccggcctctcgacg
ccctatctgaagcctgagttcaggggagcgctcctcaacctgtccttcagcgtaaggaag
gaagacatcatcaaggcgctcatagcggggatagcgatgagggtcgcggaggttatagcc
gccatggaatcgggaaccggggttgagattggctccctgacctccgacgggggcgcttcg
cagatcgacccgctcctgcagttgatagccgacttcagcgggaagagaatagttcggccg
gtggagctcaacggctccgcgcagggaaccttcatgatagcacgcgcggttgccgaggga
agtgacgtcctgagcgcgtgggagaaacctatggtggagagggtcttcgagccgagcggg
gagaagcacgaggacttcagaaggctgtgggaggagttcatgggaaggctgctctga

DBGET integrated database retrieval system