KEGG   Thermococcus gammatolerans: TGAM_1026Help
Entry
TGAM_1026         CDS       T00920                                 

Gene name
glpK-1
Definition
glycerol kinase (glpK) (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tga  Thermococcus gammatolerans
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    TGAM_1026 (glpK-1)
Enzymes [BR:tga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     TGAM_1026 (glpK-1)
Exosome [BR:tga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TGAM_1026 (glpK-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
977795..979291
Genome map
AA seq 498 aa AA seqDB search
MSYYLILDVGTTNVKAYAFSEEGEVLLKKSMRTRPVYPEPGWAELDPEELIETVRRLIDG
VTSSLGMPKGMAITNQRSSTVVWDDEGALHNMITWQDTRTKDIVEAFSRNFLVRFGRALG
KVFYGLSRIVPGIASLPKGAYIITLAHVGFGTSHSSMHLRWLMDNVPEVRKAVEDGTAKF
GTMDSWIAWNLTGKHVTDYTNASATGLFDPFYLKWSDNIMGIVGIPKKILPALQPNDLPV
GETDYGVPLLTMVADQQAALYRAGVEPGSAKMTHGTGTFIDLNVGEKPKPASPGLYPMVA
LKTRKKTLYLLEGIINASGSAVDWLLSVGLIKDYSEISAAFKDPTLPRVLFIPAFAGLST
PYLKPEFRGALLNLSFSVRKEDIIKALIAGIAMRVAEVIAAMESGTGVEIGSLTSDGGAS
QIDPLLQLIADFSGKRIVRPVELNGSAQGTFMIARAVAEGSDVLSAWEKPMVERVFEPSG
EKHEDFRRLWEEFMGRLL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagttactacctcatcctggacgttgggactacgaacgtcaaggcctacgctttttcc
gaggagggggaggtgctcctgaagaagagcatgagaacacggcccgtttatccggagcct
ggctgggccgaactcgaccccgaagagctcattgaaacggtcaggcggctcatagacggg
gttacctcttcccttgggatgccaaagggaatggccatcaccaaccagcggagctccacc
gtcgtgtgggacgacgaaggagcgctccacaacatgataacctggcaggacacgaggacc
aaagatatcgtggaggccttttcccgcaacttcctcgttcgctttggtagggctctcgga
aaggtcttctacggactctcccgcatcgttcccggaatagccagcctaccaaagggagcc
tatataatcaccctggcccacgtgggcttcggcacttcccactcctcgatgcacctacgc
tggctaatggacaacgtgccagaagtcaggaaggccgtcgaggatggaactgcgaagttc
ggcacgatggacagctggatagcgtggaacctgacggggaagcatgtgacggactacacg
aacgcatccgcgacgggcctctttgacccgttctacctcaagtggagcgacaacatcatg
ggcatcgtgggaattcccaagaaaattcttcccgccctccagccgaacgacctcccagtg
ggggaaacggactacggtgtgcccctcctcacgatggtggcggatcagcaggcggccctt
taccgtgcgggtgttgagccggggagcgcgaagatgacccacggaacggggacgttcatt
gacctgaacgtaggcgagaagccgaagccagcgtcgccaggcctctacccgatggtcgcc
cttaaaaccaggaaaaagacgctctacctcctcgagggaataataaacgcctccggctcg
gccgttgactggctcctgagcgttggcctcatcaaggactactctgagatcagcgctgcg
tttaaagatcccacccttccaagggtgctcttcatacccgccttcgccggcctctcgacg
ccctatctgaagcctgagttcaggggagcgctcctcaacctgtccttcagcgtaaggaag
gaagacatcatcaaggcgctcatagcggggatagcgatgagggtcgcggaggttatagcc
gccatggaatcgggaaccggggttgagattggctccctgacctccgacgggggcgcttcg
cagatcgacccgctcctgcagttgatagccgacttcagcgggaagagaatagttcggccg
gtggagctcaacggctccgcgcagggaaccttcatgatagcacgcgcggttgccgaggga
agtgacgtcctgagcgcgtgggagaaacctatggtggagagggtcttcgagccgagcggg
gagaagcacgaggacttcagaaggctgtgggaggagttcatgggaaggctgctctga

DBGET integrated database retrieval system