KEGG   Thermococcus gammatolerans: TGAM_1201Help
Entry
TGAM_1201         CDS       T00920                                 

Gene name
acdA-5
Definition
acetyl-CoA synthetase subunit alpha (EC:6.2.1.13)
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
tga  Thermococcus gammatolerans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TGAM_1201 (acdA-5)
   00620 Pyruvate metabolism
    TGAM_1201 (acdA-5)
   00640 Propanoate metabolism
    TGAM_1201 (acdA-5)
Enzymes [BR:tga01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     TGAM_1201 (acdA-5)
Lipid biosynthesis proteins [BR:tga01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TGAM_1201 (acdA-5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1135410..1136801
Genome map
AA seq 463 aa AA seqDB search
MVDPNIEALFKPKSIAVIGASEKPGKIGYAIMKNLVEYGYEGKIYPVNIKGVEIKIGNRV
FKSYKSILDVPDEVDMAVIVVPAKFVPQVVEECGKKGVKVLPIISSGFGELGPEGKKIEQ
QLVETAHKYGMRILGPNIFGVVYTPEKLNATFGPTDVMPGKLALISQSGALGIALMGWTI
LEKVGLSAVVSIGNKSDIDDADLLEYFETDENTKAILIYMEGVKDGRRFMEVAKKVSKVK
PIVIIKAGRSERGAKAAASHTGSLAGSDKIYDAAFKQAGIIRALTIGEAFDYARTLSNLP
EPAGENLVILTNGGGIGVMATDAAEEAGLHLYDDLDELKVFSNYMPPFGSYKNPVDLTGM
AGAESYEGAIKAALEHPEMHSIAVLYCQTAVLDPRDLADIVIREYNASGRKKPLVVAIVG
GIEAKEAIDRLNEEGIPAYPEPERAIKALAALYRWSRWKARGR
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggttgacccgaacatcgaggcccttttcaagccgaagagcatcgccgtcataggcgct
tcggagaaaccgggaaagataggctacgcgattatgaaaaacctcgtggagtacggctac
gagggcaaaatataccccgtcaacatcaagggcgttgagataaagattggcaaccgcgtc
ttcaagtcctacaagagcatcctcgatgtccccgatgaggtggatatggcggttatagtc
gttccagccaagttcgtcccccaggtcgttgaggagtgcggaaagaaaggcgtcaaggtt
ctcccgattataagttccggtttcggcgagctaggtcctgagggcaagaagatcgagcag
cagctcgttgagactgcccacaagtatggaatgaggatcctcggcccgaacatcttcggg
gttgtgtacacccccgagaagctcaacgcaacctttgggccaaccgacgtaatgcccgga
aagctggccctcatcagccagagcggtgctctgggaatagcccttatgggctggactatc
ctggagaaagtcggcctttcggcggtcgttagcataggaaacaagagcgacatcgacgat
gcagacctgctcgagtacttcgaaactgatgagaacacaaaggccatactcatctatatg
gagggtgtcaaggacggaaggcgctttatggaggttgcgaagaaggtcagcaaggtcaag
ccgatcgtcattattaaggcggggaggagcgagcgcggtgccaaggctgccgcttcccac
acaggctctctggctggaagtgacaagatttatgacgccgccttcaagcaggccggaatt
ataagggcccttacaataggagaggccttcgactacgcgagaaccctcagcaatctgccc
gagccagccggggagaacctcgtcatactcacaaacggcggtggaataggcgtcatggcc
accgacgcggccgaggaagcaggcctgcacctctacgacgacctcgatgagctcaaggta
ttctcaaactatatgcctccctttggttcctacaagaaccccgttgaccttacaggtatg
gccggtgccgagagctacgagggggcaattaaagcggccctcgagcacccggagatgcac
agcatagccgtcctctactgtcagacggcagttcttgacccgagggatttggccgacata
gtcatccgtgagtacaacgccagcggaagaaagaagccgctcgtcgttgccatcgtcggt
ggaatcgaggccaaggaagccatcgacaggctcaacgaggagggaatcccagcctatccg
gagccggagagggccataaaggctctggcagcgctctaccgctggagcaggtggaaggcc
agggggagatga

DBGET integrated database retrieval system