KEGG   Thermococcus gammatolerans: TGAM_1489Help
Entry
TGAM_1489         CDS       T00920                                 

Gene name
rps27e
Definition
30S ribosomal protein S27e
Orthology
K02978  
small subunit ribosomal protein S27e
Organism
tga  Thermococcus gammatolerans
Pathway
Ribosome
Module
Ribosome, archaea
Class
Genetic Information Processing; Translation; Ribosome [PATH:tga03010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1399906..1400103)
Genome map
AA seq 65 aa AA seqDB search
MALPKNLIPMPRSRFLRVKCIDCGNEQIVFSHPATKVRCLVCGATLVEPTGGKGVIKAKI
LEVLE
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcccgaagaacctcatcccgatgccgaggagcaggttcctccgcgtcaagtgc
attgactgcggcaacgagcagatagtcttcagccaccctgctactaaggtccgctgcctc
gtctgcggtgcaacgctcgtcgaaccgaccggcggaaagggtgtcatcaaggccaaaatc
ctcgaagttcttgagtga

DBGET integrated database retrieval system