KEGG   Thermococcus gammatolerans: TGAM_1786Help
Entry
TGAM_1786         CDS       T00920                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
tga  Thermococcus gammatolerans
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TGAM_1786
Enzymes [BR:tga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     TGAM_1786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1723308..1724819
Genome map
AA seq 503 aa AA seqDB search
MRAKVRILDVFSGRYSVFINEEEAKKAKLHPDDLVKVESGKKTIYGSLAISNLVGPGEVG
VSRDVLQLHSLSEGEVVTLTPVGTPESVRYIKKKMHGEKLRKVEIEAIVRDIVDRKLRDI
EISSFVTALEINGLDMDEIAALTIAMAETGDMLDIDRKPIMDVHSIGGVPGNKTNILVVP
IVAAAGLTIPKTSSRAITSAAGTADVVEVFTNVSFSLDEIKRIVEKVGACLVWGGALNLA
PADDITIKAERALSVDPRGLMLASIMSKKYAMGSQYVLIDIPTGKGVKVETMDEARALAR
DFIELGKRLGQYVEVAITYGGQPIGHTVGPALEAREALSALMTGKGPGSLIEKALGLAGI
LLEMGGVAPAGMGKKMAREILESGKAYEKMKEIIEEQGGDPNIKPEDIQIGDKTYTFTAP
TSGYVTGIDNRAITGIARAAGAPEDKGAGLELYVKVGEKVKEGDPLFTIHAESEARLDQA
IVFARRTEPIKIEGMVLQRIGNI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcaaaggtcagaatacttgatgtgttcagcggtaggtattcggttttcataaac
gaagaggaggcaaagaaggccaaactccacccggacgacctcgttaaagtggagtctgga
aagaagacgatctacgggagcctggctataagcaacctcgttggacccggtgaagttggt
gtgagcagggatgttctgcagctccacagtctctcagagggagaggtcgtgaccctgacg
ccagtcggcactccagagagcgttagatacatcaagaagaagatgcacggtgagaagctc
cgcaaggtagagatcgaggccattgtaagggacatcgtggacaggaagctccgggacatt
gagataagctccttcgtcaccgccctcgaaatcaacgggttggatatggacgagatagcg
gccttaaccatagcgatggcagaaactggagacatgctcgacatcgacagaaagccgatc
atggacgtccacagcatcgggggcgttccgggcaacaagaccaacatcctcgtggttccg
atagtggcagccgccggtctgactattccaaagacgagctccagggcgataaccagcgcc
gcagggactgccgatgtggtagaagttttcaccaacgtcagcttctcgctcgacgagatc
aagaggatcgtggagaaggttggggcctgtctcgtctggggtggagctttgaacctagca
ccggcggatgacataaccataaaggcagagcgcgccctcagcgttgatcctcgcgggcta
atgctcgcgagcataatgtccaagaagtacgccatgggcagtcagtacgttttaatcgat
atacccactggcaagggtgttaaggttgagacgatggacgaggcaagggcccttgcaagg
gacttcatagagctcggcaagaggctgggtcagtacgtggaggttgcaataacctacggc
ggccagccaataggccacaccgtcggtccagcgctcgaggcccgggaagccctctctgcc
ctgatgacggggaaggggccgggaagcctgattgaaaaggccctgggtcttgccgggatc
ctgctcgagatgggtggcgttgctccggcgggaatgggcaaaaagatggccagggagatc
ctcgaaagcgggaaagcctacgagaagatgaaagagatcatcgaggaacagggtggagac
ccgaacataaagccagaggacatacagataggcgacaagacgtacaccttcacggcgccg
acgagtggctatgtaactggaatagacaacagggcgataacgggaatagccagagccgct
ggagcgcctgaggacaagggcgctggactggagctctacgtcaaggtcggcgaaaaggtc
aaggagggagatcccctcttcacgatccacgccgagagcgaggcaaggcttgatcaggct
atcgtcttcgcccgcaggacagaacccatcaagattgaagggatggtgctccagcgaatc
gggaacatctga

DBGET integrated database retrieval system