KEGG   Thermococcus gammatolerans: TGAM_1809Help
Entry
TGAM_1809         CDS       T00920                                 

Gene name
thrC-1
Definition
threonine synthase (EC:4.2.3.12)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tga  Thermococcus gammatolerans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TGAM_1809 (thrC-1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TGAM_1809 (thrC-1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TGAM_1809 (thrC-1)
Enzymes [BR:tga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TGAM_1809 (thrC-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1742363..1743535
Genome map
AA seq 390 aa AA seqDB search
MRCIECGREYDENELRYRCDCGGLLEVVTDLERAEDVFDGKNVTLWKYESWLPVRKRVSL
NEGGTPLYRLSNLERELGVELYAKNEGANPTGSFKDRGMTVGVSKALELGMDKVICASTG
NTSASLAAYAAKAGIKAYVLVPSGKIALGKLAQAIIYGARVVPVKGNFDDALRVVVEASA
KLGVYMLNSINPFRLEGQKTIALEIYDQLGFVPDNVVLPVGNAGNISAIWKGFKELYEKG
ITDELPRMIGIQAEGAAPLARAWKAKKPFEPVENPETVATAIRIGNPANWPKAWRAVEES
GGLFESVSDGEILRAQELLASREGLFVEPASAAPLAGLMKLLESGELDRGESYVLVTTGH
GLKDPNVVVNRFTLPKPIEPTLEAFREVMK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
ttgaggtgtatcgaatgcggtagggaatacgatgaaaacgagctccgctatagatgcgac
tgcggtggcctacttgaggttgttaccgaccttgagagggccgaggacgttttcgatgga
aagaacgtgacgctgtggaagtacgagagctggcttcccgtgaggaagagggtttcgctg
aacgagggtggaacgcccctctacaggctcagcaacctcgagagggaactcggcgttgag
ctctacgccaagaacgagggagccaacccaacaggctccttcaaggacaggggcatgacg
gttggagtatccaaggccctcgaactcggcatggacaaggtgatatgcgcttcaacgggc
aacacttcggcttccctcgcggcctacgcggccaaggcgggaataaaggcctacgtcttg
gtgccgagcggtaagatagccctcggaaagcttgcgcaggcgataatctacggggcgagg
gtcgttccagttaagggcaactttgacgacgccctcagggtcgttgttgaggcgagcgca
aagctcggcgtctacatgctcaactcgataaatccattccgcctcgagggtcagaagacg
atagcgctcgaaatctacgaccagctcggcttcgtgccggacaacgtcgtccttccggtt
ggaaacgcgggaaacatctcggcgatatggaagggcttcaaggagctctacgagaagggg
ataaccgatgagctcccccgcatgatagggatacaggccgagggcgcggcaccgctcgcg
agggcctggaaggccaaaaagccgttcgagcccgttgaaaaccccgagacggttgccacc
gccataaggataggcaaccccgccaactggcccaaggcctggcgcgcggttgaggaatct
gggggcctctttgagagcgtgagcgacggggagatacttagggctcaggaactgctcgcg
agcagggagggcctcttcgtcgagcccgcctccgcggctcccctggcgggcctcatgaag
ctcctcgaaagcggggagcttgacaggggcgaaagctacgtcctcgtaacgacggggcac
gggcttaaggacccgaacgtcgtcgtaaaccgcttcacccttcccaagccaatagagccg
acgctcgaagccttcagggaggtgatgaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system