KEGG   Thermococcus gammatolerans: TGAM_1809Help
Entry
TGAM_1809         CDS       T00920                                 

Gene name
thrC-1
Definition
(RefSeq) threonine synthase (EC:4.2.3.12)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tga  Thermococcus gammatolerans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TGAM_1809 (thrC-1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TGAM_1809 (thrC-1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TGAM_1809 (thrC-1)
Enzymes [BR:tga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TGAM_1809 (thrC-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1742363..1743535
Genome map
AA seq 390 aa AA seqDB search
MRCIECGREYDENELRYRCDCGGLLEVVTDLERAEDVFDGKNVTLWKYESWLPVRKRVSL
NEGGTPLYRLSNLERELGVELYAKNEGANPTGSFKDRGMTVGVSKALELGMDKVICASTG
NTSASLAAYAAKAGIKAYVLVPSGKIALGKLAQAIIYGARVVPVKGNFDDALRVVVEASA
KLGVYMLNSINPFRLEGQKTIALEIYDQLGFVPDNVVLPVGNAGNISAIWKGFKELYEKG
ITDELPRMIGIQAEGAAPLARAWKAKKPFEPVENPETVATAIRIGNPANWPKAWRAVEES
GGLFESVSDGEILRAQELLASREGLFVEPASAAPLAGLMKLLESGELDRGESYVLVTTGH
GLKDPNVVVNRFTLPKPIEPTLEAFREVMK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
ttgaggtgtatcgaatgcggtagggaatacgatgaaaacgagctccgctatagatgcgac
tgcggtggcctacttgaggttgttaccgaccttgagagggccgaggacgttttcgatgga
aagaacgtgacgctgtggaagtacgagagctggcttcccgtgaggaagagggtttcgctg
aacgagggtggaacgcccctctacaggctcagcaacctcgagagggaactcggcgttgag
ctctacgccaagaacgagggagccaacccaacaggctccttcaaggacaggggcatgacg
gttggagtatccaaggccctcgaactcggcatggacaaggtgatatgcgcttcaacgggc
aacacttcggcttccctcgcggcctacgcggccaaggcgggaataaaggcctacgtcttg
gtgccgagcggtaagatagccctcggaaagcttgcgcaggcgataatctacggggcgagg
gtcgttccagttaagggcaactttgacgacgccctcagggtcgttgttgaggcgagcgca
aagctcggcgtctacatgctcaactcgataaatccattccgcctcgagggtcagaagacg
atagcgctcgaaatctacgaccagctcggcttcgtgccggacaacgtcgtccttccggtt
ggaaacgcgggaaacatctcggcgatatggaagggcttcaaggagctctacgagaagggg
ataaccgatgagctcccccgcatgatagggatacaggccgagggcgcggcaccgctcgcg
agggcctggaaggccaaaaagccgttcgagcccgttgaaaaccccgagacggttgccacc
gccataaggataggcaaccccgccaactggcccaaggcctggcgcgcggttgaggaatct
gggggcctctttgagagcgtgagcgacggggagatacttagggctcaggaactgctcgcg
agcagggagggcctcttcgtcgagcccgcctccgcggctcccctggcgggcctcatgaag
ctcctcgaaagcggggagcttgacaggggcgaaagctacgtcctcgtaacgacggggcac
gggcttaaggacccgaacgtcgtcgtaaaccgcttcacccttcccaagccaatagagccg
acgctcgaagccttcagggaggtgatgaaatga

DBGET integrated database retrieval system