KEGG   Thermococcus gammatolerans: TGAM_1811Help
Entry
TGAM_1811         CDS       T00920                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tga  Thermococcus gammatolerans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TGAM_1811 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TGAM_1811 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TGAM_1811 (trpB)
Enzymes [BR:tga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TGAM_1811 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1744548..1745870)
Genome map
AA seq 440 aa AA seqDB search
MKAVLPDSKIPKRWYNILPDLPEPLAPPLDPETDEPIEPEKLLRIFAEELVKQEMSTERY
IEIPKKVRELYAKIGRPTPLFRATNLEKALGTPARIYFKYEGATVTGSHKINTALAQAYY
AKEQGIERLVTETGAGQWGTALSLAGALLGLKIRVYMARASYQQKPYRKTIMRLYGAEIY
PSPSDRTEIGRKFLSEDPNHPGGLGIAISEAIEDVLKDEKARYALGSVLNHVLMHQTVIG
LEAQEQMKEFEEPDVIIGCVGGGSNFAGLAYPFVRDVLSGKADYEFIAVEPKAAPSMTRG
VYKYDFGDSGGYTPKMKMHTLGHTYYVPPIHAGGLRYHGLAPTLSILINHGIVKPVAYHQ
TEVFQAAELFAKTEGIIPAPESAHAIKGVIDRALKAKEEGREEVILFNLSGHGLLDLKGY
EDYLDGKLEDYEPDYFPALG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgttctgcccgattcgaagataccgaagaggtggtacaacatactacccgac
ctcccggagcccctggcaccgcccctcgacccagaaacggatgagccaatagagccggag
aagctgttgaggattttcgcggaggagctcgtgaagcaggagatgagcacggaaaggtac
atcgagattccaaagaaagttcgtgaactctacgccaagataggtcgtccgacgccactt
ttccgcgccacaaatctcgaaaaggccctcggcacgcccgctagaatttacttcaagtac
gagggggcaaccgtaacgggaagccacaagataaacaccgccttagctcaggcctactac
gcgaaggaacagggaatagagaggctcgttaccgagactggggcgggacagtggggaacg
gctttgagcttagcgggagctctgctcggccttaaaatcagggtctacatggcgcgcgcg
agctaccagcagaagccctacaggaagacgataatgcgcctctacggggccgaaatctac
cccagtccgagcgacagaacggaaattggacggaagttcctgagcgaggaccccaaccac
cctggagggctgggaatagcgataagcgaggcgattgaagacgttttaaaggacgaaaaa
gcccgctacgccctcggaagcgtcctcaatcatgtgctcatgcaccagactgttataggc
ctcgaagcccaggagcagatgaaggagttcgaagagccggacgttataatcggctgcgtc
ggcggtggaagcaacttcgcgggattggcatacccgttcgttagggacgttctgagtgga
aaggccgactacgagttcatagcggtcgagccgaaggccgccccgagcatgacgcgcggg
gtttacaagtacgactttggcgattccggcggttacaccccaaagatgaagatgcacaca
ctcggccacacctactacgtcccgccgattcacgcaggtggccttcgttaccacggcttg
gctccaacgctgagtatactcataaaccacggaatagtcaagccagtcgcttaccaccag
accgaggtcttccaagctgccgagctgttcgcgaagacggagggtataatcccagccccg
gagagcgcccacgcgataaagggcgtaatagacagggcgttgaaagcgaaggaagaagga
agggaggaggtcatactcttcaacctgagcggtcacggtctcctcgacctgaagggctac
gaggattacctggacggcaagctcgaagattatgagccggactacttcccggccctcggc
tga

DBGET integrated database retrieval system