KEGG   Thermococcus gammatolerans: TGAM_1811Help
Entry
TGAM_1811         CDS       T00920                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase, beta chain-like (trpB)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tga  Thermococcus gammatolerans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TGAM_1811 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TGAM_1811 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TGAM_1811 (trpB)
Enzymes [BR:tga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TGAM_1811 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1744548..1745870)
Genome map
AA seq 440 aa AA seqDB search
MKAVLPDSKIPKRWYNILPDLPEPLAPPLDPETDEPIEPEKLLRIFAEELVKQEMSTERY
IEIPKKVRELYAKIGRPTPLFRATNLEKALGTPARIYFKYEGATVTGSHKINTALAQAYY
AKEQGIERLVTETGAGQWGTALSLAGALLGLKIRVYMARASYQQKPYRKTIMRLYGAEIY
PSPSDRTEIGRKFLSEDPNHPGGLGIAISEAIEDVLKDEKARYALGSVLNHVLMHQTVIG
LEAQEQMKEFEEPDVIIGCVGGGSNFAGLAYPFVRDVLSGKADYEFIAVEPKAAPSMTRG
VYKYDFGDSGGYTPKMKMHTLGHTYYVPPIHAGGLRYHGLAPTLSILINHGIVKPVAYHQ
TEVFQAAELFAKTEGIIPAPESAHAIKGVIDRALKAKEEGREEVILFNLSGHGLLDLKGY
EDYLDGKLEDYEPDYFPALG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgttctgcccgattcgaagataccgaagaggtggtacaacatactacccgac
ctcccggagcccctggcaccgcccctcgacccagaaacggatgagccaatagagccggag
aagctgttgaggattttcgcggaggagctcgtgaagcaggagatgagcacggaaaggtac
atcgagattccaaagaaagttcgtgaactctacgccaagataggtcgtccgacgccactt
ttccgcgccacaaatctcgaaaaggccctcggcacgcccgctagaatttacttcaagtac
gagggggcaaccgtaacgggaagccacaagataaacaccgccttagctcaggcctactac
gcgaaggaacagggaatagagaggctcgttaccgagactggggcgggacagtggggaacg
gctttgagcttagcgggagctctgctcggccttaaaatcagggtctacatggcgcgcgcg
agctaccagcagaagccctacaggaagacgataatgcgcctctacggggccgaaatctac
cccagtccgagcgacagaacggaaattggacggaagttcctgagcgaggaccccaaccac
cctggagggctgggaatagcgataagcgaggcgattgaagacgttttaaaggacgaaaaa
gcccgctacgccctcggaagcgtcctcaatcatgtgctcatgcaccagactgttataggc
ctcgaagcccaggagcagatgaaggagttcgaagagccggacgttataatcggctgcgtc
ggcggtggaagcaacttcgcgggattggcatacccgttcgttagggacgttctgagtgga
aaggccgactacgagttcatagcggtcgagccgaaggccgccccgagcatgacgcgcggg
gtttacaagtacgactttggcgattccggcggttacaccccaaagatgaagatgcacaca
ctcggccacacctactacgtcccgccgattcacgcaggtggccttcgttaccacggcttg
gctccaacgctgagtatactcataaaccacggaatagtcaagccagtcgcttaccaccag
accgaggtcttccaagctgccgagctgttcgcgaagacggagggtataatcccagccccg
gagagcgcccacgcgataaagggcgtaatagacagggcgttgaaagcgaaggaagaagga
agggaggaggtcatactcttcaacctgagcggtcacggtctcctcgacctgaagggctac
gaggattacctggacggcaagctcgaagattatgagccggactacttcccggccctcggc
tga

DBGET integrated database retrieval system