KEGG   Thermococcus gammatolerans: TGAM_2077Help
Entry
TGAM_2077         CDS       T00920                                 

Gene name
thrC-2
Definition
Threonine synthase (thrC) (EC:4.2.3.12)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tga  Thermococcus gammatolerans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TGAM_2077 (thrC-2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TGAM_2077 (thrC-2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TGAM_2077 (thrC-2)
Enzymes [BR:tga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TGAM_2077 (thrC-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1972345..1973484
Genome map
AA seq 379 aa AA seqDB search
MKVKGKLKCSICGKTYDKPLQRCGCGEPVEFELFEGEPYIGKSVWERFWDFWPLEPALDF
SLGEGDTPLVKSRLGDEFGIKLYLKNETVNPTWSFKDRGTFLAMSYALKAGYKTVGTVST
GNMAASVSAYATRFGLKAKILVSESAGDEKLKAVSVYGGEVIRVHGDYGRLYFESLKLGE
RLGVYFMNSDNPLRIEGYKSIAFEIAEEISPDYILIPTSSGGLFRGVAKGFIELYKSGLI
EGLPKLIAVQAEGCSPICMAFREGREKVERFENPRTIAKAIANPYPPSGNALLKLLREFG
WGCVSVSDDEIRKAQERLAREGLFVQPASATGIAALEKLNLPEGAKVVSVLTGSGLKVLG
DVPKRDIKECSLERLTECF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgaaggggaagttgaagtgctcaatctgtggaaagacatatgacaaaccgctt
caaagatgtggatgcggtgagcccgtcgagttcgagctcttcgagggagaaccctacata
gggaagagcgtctgggagcggttctgggacttctggccgctcgagcccgcgcttgacttt
tcccttggcgagggcgacactccgctggttaagtcaaggctcggcgacgagtttggaata
aagctctacctcaagaacgagactgtgaacccgacgtggagcttcaaggacaggggaact
tttctggcgatgagctatgccctcaaagccggctacaaaaccgttgggacggtctcgact
ggaaacatggcggcgagcgtctctgcctacgccacccgcttcggacttaaagctaaaatt
ctcgtctccgagagcgcgggcgacgagaaattaaaggccgtctcggtctacggcggagaa
gtgataagggttcacggcgactacgggaggctctacttcgagagcctcaagctgggagaa
aggctcggggtctatttcatgaactcggacaaccccctcagaatagagggctacaagagt
atcgcatttgagatagccgaggagataagcccggactacattctgattccgaccagctcg
ggcggtcttttcaggggagtggcaaagggcttcatcgagctttacaagagcggtctcatt
gaaggcctcccaaagctgatagccgtccaggccgagggctgttctccgatatgcatggcc
ttccgcgaggggagggaaaaggtggagcgcttcgagaacccgagaacgatagcgaaggca
atagcgaacccctacccgccgagcggcaacgcgcttctgaaactcctgagggagtttggc
tggggttgcgtttcagtttcggacgatgaaatcagaaaagctcaggaaaggctcgcccgc
gaaggcctcttcgtccagccagcgagcgcaacggggatagcggctctggaaaagctgaac
cttccagagggggctaaggtcgtctcggttctcacgggttctgggctgaaggttcttggc
gacgtacctaagagagacataaaggagtgttcgcttgaacgtctgaccgagtgtttttag

DBGET integrated database retrieval system