KEGG   Thermococcus gammatolerans: TGAM_2077Help
Entry
TGAM_2077         CDS       T00920                                 

Gene name
thrC-2
Definition
(GenBank) Threonine synthase (thrC)
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tga  Thermococcus gammatolerans
Pathway
tga00260  Glycine, serine and threonine metabolism
tga00750  Vitamin B6 metabolism
tga01100  Metabolic pathways
tga01110  Biosynthesis of secondary metabolites
tga01120  Microbial metabolism in diverse environments
tga01230  Biosynthesis of amino acids
Module
tga_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TGAM_2077 (thrC-2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TGAM_2077 (thrC-2)
Enzymes [BR:tga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TGAM_2077 (thrC-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACS34579
UniProt: C5A2G0
Position
1972345..1973484
Genome map
AA seq 379 aa AA seqDB search
MKVKGKLKCSICGKTYDKPLQRCGCGEPVEFELFEGEPYIGKSVWERFWDFWPLEPALDF
SLGEGDTPLVKSRLGDEFGIKLYLKNETVNPTWSFKDRGTFLAMSYALKAGYKTVGTVST
GNMAASVSAYATRFGLKAKILVSESAGDEKLKAVSVYGGEVIRVHGDYGRLYFESLKLGE
RLGVYFMNSDNPLRIEGYKSIAFEIAEEISPDYILIPTSSGGLFRGVAKGFIELYKSGLI
EGLPKLIAVQAEGCSPICMAFREGREKVERFENPRTIAKAIANPYPPSGNALLKLLREFG
WGCVSVSDDEIRKAQERLAREGLFVQPASATGIAALEKLNLPEGAKVVSVLTGSGLKVLG
DVPKRDIKECSLERLTECF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgaaggggaagttgaagtgctcaatctgtggaaagacatatgacaaaccgctt
caaagatgtggatgcggtgagcccgtcgagttcgagctcttcgagggagaaccctacata
gggaagagcgtctgggagcggttctgggacttctggccgctcgagcccgcgcttgacttt
tcccttggcgagggcgacactccgctggttaagtcaaggctcggcgacgagtttggaata
aagctctacctcaagaacgagactgtgaacccgacgtggagcttcaaggacaggggaact
tttctggcgatgagctatgccctcaaagccggctacaaaaccgttgggacggtctcgact
ggaaacatggcggcgagcgtctctgcctacgccacccgcttcggacttaaagctaaaatt
ctcgtctccgagagcgcgggcgacgagaaattaaaggccgtctcggtctacggcggagaa
gtgataagggttcacggcgactacgggaggctctacttcgagagcctcaagctgggagaa
aggctcggggtctatttcatgaactcggacaaccccctcagaatagagggctacaagagt
atcgcatttgagatagccgaggagataagcccggactacattctgattccgaccagctcg
ggcggtcttttcaggggagtggcaaagggcttcatcgagctttacaagagcggtctcatt
gaaggcctcccaaagctgatagccgtccaggccgagggctgttctccgatatgcatggcc
ttccgcgaggggagggaaaaggtggagcgcttcgagaacccgagaacgatagcgaaggca
atagcgaacccctacccgccgagcggcaacgcgcttctgaaactcctgagggagtttggc
tggggttgcgtttcagtttcggacgatgaaatcagaaaagctcaggaaaggctcgcccgc
gaaggcctcttcgtccagccagcgagcgcaacggggatagcggctctggaaaagctgaac
cttccagagggggctaaggtcgtctcggttctcacgggttctgggctgaaggttcttggc
gacgtacctaagagagacataaaggagtgttcgcttgaacgtctgaccgagtgtttttag

DBGET integrated database retrieval system