KEGG   Thermococcus gammatolerans: TGAM_2147Help
Entry
TGAM_2147         CDS       T00920                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (galU) (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tga  Thermococcus gammatolerans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TGAM_2147 (galU)
   00052 Galactose metabolism
    TGAM_2147 (galU)
   00500 Starch and sucrose metabolism
    TGAM_2147 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    TGAM_2147 (galU)
Enzymes [BR:tga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TGAM_2147 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2033808..2034686
Genome map
AA seq 292 aa AA seqDB search
MRVRKAVIPAAGLGTRMLPITKSMPKEMLPIVDKPVIHYVVEEAIKAGIDDILIITGKGK
RAIEDYFDRSFELEFYLREKGKFEELKQIEEIGEMVDIYYVRQKKPLGLGDAILHAEKHV
NGEPFAVLLGDDIIVSEKPGIKQLIEIAERREAPVIGVERVPWELVSRYGIVDGEPLGDG
VYQVKHLVEKPSPQEAPSNVAIIGRYVLTPEVFDALRETPPGRGGELQLTDALQELLSSQ
NIFAKEIKGERYDVGSKLGFVIANIELSLKRGELREELLTFLKNLLREVSDE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgagggttaggaaggcagtaataccagcagctggcctcggtacgagaatgctacccata
accaagtcgatgcccaaggaaatgctgccgatagttgacaaacctgtcatccactacgtt
gttgaagaggcaatcaaagccggaatcgacgacattctcatcataaccggaaagggaaag
cgtgccatagaggactacttcgacagaagcttcgagctggagttctatctccgggaaaag
ggaaagttcgaagagctgaagcagatagaggaaattggcgagatggttgatatctactac
gtccgccagaagaagcccctaggtcttggtgatgcgatactccacgcagaaaaacacgtg
aacggagagccctttgctgtcctccttggagacgacatcatagtaagcgaaaagcccggg
ataaagcagctcatcgagatagccgagcggagagaagctccagtaataggagtggagcgc
gttccctgggaacttgtaagccggtacggaatcgtggacggggaacccttgggcgatgga
gtttaccaagtgaaacacctcgtggagaagccctccccccaagaggccccgagcaacgtt
gcaataatcgggaggtacgtcctgacacctgaggtattcgacgccctgagagaaactcct
ccggggaggggtggcgagttacagctcacggacgccctccaggaacttctatctagccag
aacatcttcgctaaggagataaaaggcgagagatatgacgttggaagtaagcttgggttc
gtcatagcgaacattgaactgagcctaaagagaggggaactgagagaggagttgctaacc
ttcctcaaaaatctcctaagggaggtctcagatgagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system