KEGG   Toxoplasma gondii: TGME49_006610Help
Entry
TGME49_006610     CDS       T01093                                 

Definition
biotin requiring domain-containing protein / 2-oxo acid dehydrogenases acyltransferase catalytic domain-containing protein (EC:6.4.1.4 2.3.1.12 2.3.1.168)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tgo  Toxoplasma gondii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tgo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tgo00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tgo00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tgo00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 932 aa AA seqDB search
MALPSPGILVHVSLFLAAVSSAFGLQLVPSSSPAPSASSTSFSGSSAPAFVAPAVSSGSG
VHSTRPRFFASPSASSASSVSSTNAGQRPLSAGSSLQTRERRCGSRLTSSLLCAAEGTVR
RQETAVGSSLRGAVQEISMPALSSTMKEGKVVTWSKQVGDRVEPGDVLMVVESDKADMDV
EAFDSGFMAMHLVREGDAAPVGTTVALLAEKEEDISLIQAKGLSLISASSSPAADSTPAV
TDLLMPSLSPSLKTARMTVWRKKEGEKVNKGDVLFVVESDKADMDVEAPHDGVLAHIAVR
EGVTVDVGSTVGYLAPSAEVASAFKNALSDSAAPAAANPSTMPEGAQEIFMPALSSTMTS
GKVSKWNKAVGDAVHVGDTLMVVESDKADMDVESFDEGYLAAITVAEGESAPVGQTVAII
VPSKDDIAKVQDALTAASTASSSSPAHAPLSSASSPSTPSSRLSSSDSVSVSSSQSGRPT
TGGDSRTAAFMKHGQALARWTSPSVDQDVKDQLPEGLTGNDLQQEWLQRIEATMPTTFAA
LQANPQMQKALLERLNLRVPPPHTLRVSPAPPPYLKRAVSTYGAATAGVPDTRASGIDRT
SRGPARDPSGQPLATFNAIELAKKNKLNLEEVKGTGTNRRITAADVRQHLHLPSDEATVV
TSKRENEGKIESLGVPPPGSVPLDAMQKAVARNMEATMDVPVFRVSRGIYVDKLEAMVQE
LKQIVAEQNAAAIAAEGPDAPQQSTVTMSVLLAKAVALTLEKHPIMNAAYNPKDGGQIQY
VPHPGAVNVAMAVSVDGGLLTPVLRNVNTKSVFELSADWAVLVDKARKRRLTAEENSAGT
FYISNLGMFGVSQFDAVLPKGVGTIMAVGGTESVPFFPKTGTLDAPAGNPSVRRRMTVTI
TADHRHIYGSHAAAFLKDFASLLETRPSALLI
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgccttcacccggtattctcgtccatgtctctctcttcctagcggccgtctcc
tctgcctttgggctccagctcgtcccctcttcctcgcccgctccttcggcttcctctacc
tccttctcaggctcctcggcgcccgcgtttgtcgctccagctgtctcttccggctctggc
gtccactccacgcgcccccgtttcttcgcgtctccttctgcatcctcagcgtcttctgtt
tcctcgacgaacgcaggacagagacctctgtcggcggggtcttctcttcagactcgggag
cgaagatgtggatcgaggctcacgtcgtcgctcctctgcgcggctgaggggacagtcagg
agacaggagacagctgtgggctcaagcctccgcggagctgtccaggaaatctcgatgcct
gcgctctccagcacgatgaaggagggcaaagtcgtcacgtggtcgaaacaagtcggagac
cgtgtcgagccgggggacgtgctcatggtggtcgagagcgataaagccgacatggatgtc
gaggcctttgactcaggcttcatggcaatgcacctagttcgggagggtgacgcggcgccg
gttggcacaactgtcgcccttctggccgagaaggaagaggacatttctttgattcaagcg
aagggtctttcactcatctccgcttcttcgtctcctgctgccgattcaactccagctgtc
actgacttgctgatgccttcgttgtctccgagtttgaaaacggcacggatgacggtttgg
cggaagaaggaaggcgagaaagtcaacaagggcgacgttcttttcgtcgtcgagagcgac
aaagccgacatggacgtcgaggctcctcacgatggtgtcttggcccatatcgcagttcgt
gagggcgtgacagtcgatgtggggtcgacggtcggctacctcgcccccagtgccgaggtg
gcttcagccttcaagaacgcgctgtcggactcggctgcacccgcggctgcgaatccctcg
acgatgccagaaggcgcccaagaaatcttcatgcctgctctctcttccacgatgacaagc
ggcaaagtatccaagtggaacaaggctgtcggagatgctgtgcatgtcggcgatacgctg
atggttgttgaaagtgacaaggcggacatggatgtcgaaagtttcgatgaaggctacctt
gccgcgatcacagtcgcggagggggagtctgccccggtcggtcagaccgtggccatcatt
gtcccttcgaaagatgacattgccaaagtccaggacgccctcacagcggcttccactgcc
tcctcgtcttctcccgctcacgcgcctctttcctcggcttcttctccgtctaccccttct
tcgcgcctctcttcttcggactcggtgtctgtctcttcttcccagagtgggagaccgacg
acgggtggggacagcaggacagcagccttcatgaagcacggccaggcgcttgcaaggtgg
acgtctccgtctgtggaccaagatgtgaaagatcagctgccggagggcttgacgggcaac
gatctgcaacaggagtggctgcagagaatcgaggcgacgatgccgacgacgttcgcagcg
ttgcaggccaacccgcagatgcagaaggcgctcctggagagactgaatctgcgtgtacct
cccccgcacacgctccgcgtctccccggcgcctccgccctatttgaagcgagctgtcagc
acctacggagccgcgacagctggagtacctgatacccgagccagtggcatcgacagaacg
tctcggggcccagctcgagacccttcaggacagcctctcgctacctttaacgccatcgag
ttggcgaagaaaaacaaactcaacttggaggaagtcaagggaaccgggacaaacaggcgc
atcactgcagcagatgtgcgacagcatttgcacctgccctccgacgaagccaccgtcgtc
acgagcaaaagagaaaacgagggaaaaatcgaaagcttgggcgtccctcctcctgggtcg
gttccactcgatgcaatgcaaaaggcggttgcgcggaacatggaagcaaccatggatgtt
cctgtattcagagtttcgcgaggtatttacgtcgacaagctcgaggcgatggttcaggag
ctgaagcaaattgtggcggagcaaaacgcagcagcgattgcagcggaaggcccagatgcg
cctcagcagtcaacagtgacgatgagcgtcctcctggctaaggcagttgctctcacactg
gagaagcatccgatcatgaacgccgcatataatcctaaggatggaggccaaattcagtat
gtgccgcaccccggagccgtgaacgtggcgatggctgtttcggtcgacggcggactctta
actccggttctgcgaaatgtcaacacgaaatctgttttcgagttgtcggcagactgggcc
gtacttgtcgataaggccaggaagcgtcgcctgacagcggaagaaaacagtgcaggcacc
ttttacatcagcaatctgggcatgtttggggtgagccagtttgacgcggtccttcctaaa
ggtgtagggacaatcatggctgtgggcgggacagagtcggttcccttcttccccaagact
ggaacgttggatgcaccagctggaaaccccagtgttcgtcggcgcatgacagtcaccatc
actgccgatcatcgccatatctacggttcgcatgcagctgcgtttctaaaggactttgcc
tcgcttctagaaactcgcccatctgctttgctcatctag

DBGET integrated database retrieval system