KEGG   Toxoplasma gondii: TGME49_007080Help
Entry
TGME49_007080     CDS       T01093                                 

Definition
histone acetyltransferase (EC:2.7.11.1)
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
tgo  Toxoplasma gondii
Brite
Enzymes [BR:tgo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TGME49_007080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1086 aa AA seqDB search
MQGRSDKRGTSPSGGGGAKKGESRETGTFSVEKDPWLPSSSYSDSSSESASQPRVPLSGS
CQRPFAFSSRPSSHSSLSRSGNFSRSRAAGSFSSQSPHSSRSSLNASNAAARNSSLASPR
PAHSSFSSRHSSPFSRPSAVRPSRPSATSGSSSRSSSSASSSAASLSSSASSSSSSQSFP
RQSRRVSTSPLPPVRDVPCSNSTFFSSASPQGFPSSRNRQEQRASPRSPRSTLSHSRSPP
ARRGKEDALDLSSPPSSQISEEGTRERTGKEAIRCSPNSPPGGHKRDEESERRREERRRE
GEDEIGSREEERGRGVEVRDRTEEPRKGGDEERERVDGRSKFAEEEKRRQGEERVLSCDG
AGERGRSDGEETSAEKREAKEETALKTDQDAPRERKEKDAGGAREKSPGDREGRGEGVRR
PGEEPRETTGKRTEHEESATGRDGGANEKKEKREEAQKKEKPSDKKSRPLRERGGRKSCE
EGKGDDETQSRLSLSSRISTREPRALAVHQWIGARLGHSFHPGKIISIRSIHSPASSLPF
PNSPARRQRQHRGGRTCPSCSKYMPGDSASPVCRRCGGVAPTLGAGRRAEAPELGRGARG
PSARAEASPTSCGSTTAVGGAPKTPDGGPAPGEKGDRERVAEVEKPHHYEYYVHYRHTNR
RLDTWLKFDDLRPITPDGQVLEFPAVESRRRRRKRRRDADEDDDSGDETEPKRRRHDRDE
DAALSDVENERDEGESSDRDAEDEEDSDSEMLDKLAMFDPSVQFSDHDEEAAKEHEGMDL
ATLQAHEEATKIKTIRQIQFGPFLLQTWYFSPYPAHVQDAEVLYVCEFCLSFFRHASELS
THNQRCILRHPPGDEIYREGRLSVFEVDGSVARVYSENLCFLAKLFLDHKTLQYDVEPFL
FYVLTEVDRTGCHLIGYFSKEKISLQAYNLACILTMPQHQRKGYGRFLISFSYLLSLREK
KKGGPERPLSDLGRLSYIGWWTWCLLTHMESDAQKRRRKISIEDLVRNTAVREEDIQRTL
EEIGVLRYVQGHHLLLLHPDLVKTRLKEAGSAGVLVHGENLRFVSYHRTPPAPREALPPP
RRGEED
NT seq 3261 nt NT seq  +upstreamnt  +downstreamnt
atgcagggccgaagtgataagcgggggacctcgccctctggaggcggaggcgcgaagaag
ggagagagcagggagacagggactttctctgtcgagaaggatccgtggttgccgtcgtcg
tcgtattctgattcttcgtcggagtccgcgtctcagcctcgggtgcctttgtctggtagt
tgccagcgtccctttgctttttcgtctcgcccctcttcgcattcgtctctctctcgttcc
ggcaacttctctcggtcgcgcgcggcaggttccttctcctcccagtctcctcattcctcg
cgctcctctttgaacgcgtccaacgctgcggcgcggaactcttcgttggcgtctcctcgt
cctgcgcacagttccttctcttctcgccactcctctcctttctctcgtccttccgctgtg
cggccttcacgaccttctgcaacttcgggaagttcttcgcggtcttcctcttctgcttcc
tcatcggccgcctcattgtcgtcctctgcttcgtcttcctcttcaagtcagtcttttccg
agacagtctcggcgagtctcgacctcgcctctccctccggtgcgcgatgtgccttgttcg
aattcaacattcttttcttctgcatcaccccaggggtttccctcctcgagaaatcgacaa
gagcagcgcgcctctcctcgctctccgcggtcaaccttgtcgcactctcgttcgccgcct
gcgcgccgaggcaaagaggacgcgctggacttgtcgtctccaccttcttcgcagataagc
gaggaaggaacaagagagcgaaccggcaaagaggcaatccgctgctcgcccaacagcccc
cccggcggccacaaaagagacgaagagagtgaacgaagacgagaagagcgaagacgggaa
ggagaagatgaaataggaagcagagaagaagagcgagggcgtggggttgaggttagagac
agaacagaagaaccgagaaaaggaggagacgaagagagagaaagagtggacggaagaagc
aagtttgcagaggaggagaagagacgtcagggagaagaacgtgtgttgagctgcgacggc
gcaggagagagagggagaagcgacggagaagagacctccgcagagaagagggaagcaaag
gaagagacagctctgaagacagaccaagacgcaccgcgagaaagaaaagagaaggatgcg
ggaggagcaagagagaagagtccaggagacagagaaggaagaggagaaggagtaagacgc
cccggagaggagccacgagaaacgactggaaaacgaactgagcatgaagagagtgccacc
ggacgcgatggtggagcgaacgagaagaaagagaagagagaggaggcacagaagaaagag
aaaccgagtgacaagaaaagtcgacctctcagagagcgaggcggccgcaagagctgtgaa
gaaggcaaaggagacgacgaaacacaaagtcgactgtcgctttcttctcggatttcgacc
agagagcctcgagcacttgcagtccaccagtggataggcgcgcggcttggtcacagtttt
catcctggaaaaatcatcagcatccgctcgattcattcgccggcttcttcgctgcctttc
ccgaactcccctgcgcgccgccagcggcaacaccgcggcggaagaacctgtccttcgtgc
tcgaagtatatgcctggcgactccgcgtctccagtctgtcggcgctgcgggggtgtggcg
ccgaccctgggcgctggccggcgggcggaggcgccggagcttgggcgcggggcccgaggg
ccatccgcgcgcgcagaagcgagcccaactagctgcggctccacgaccgcggtcggaggg
gcgccgaagacgccagacggcggaccagcgcccggcgaaaaaggcgaccgcgagcgggtg
gcggaagtcgagaaaccgcatcactacgaatactacgtccactaccgccacacaaacaga
cgcttggatacatggctgaagttcgacgacctgcgccccatcacaccggacgggcaggtg
ctcgagttccccgcagtcgagagcagacgaaggcgacgaaagcgaagacgcgacgcagac
gaggacgacgactcaggcgacgagacagagcctaagcgaaggagacacgaccgagacgaa
gacgcggcgctcagtgacgtggaaaacgaaagagacgaaggagagagctcggaccgcgac
gcggaagacgaggaagacagtgactcggagatgctggacaagctcgcgatgttcgacccc
agtgtacagttttcagatcacgacgaagaagcggcgaaggagcacgaaggcatggatttg
gccaccctccaggcgcatgaagaagcgacgaaaatcaagacgattcggcagatccagttc
gggccgtttctcctccaaacgtggtatttctcgccgtaccctgcccatgtacaagacgca
gaagttctttacgtctgcgaattctgcctctcgttcttccgccatgccagcgaactctcc
acccacaaccaaagatgcatcctcagacatcctcccggcgacgaaatctaccgggaagga
agactctccgtctttgaggtggatggcagtgttgctcgcgtttacagcgaaaacctctgc
ttccttgccaagctcttccttgaccacaagacactccaatacgacgtcgagccgttcctc
ttctacgtcctcactgaggtcgaccgaacggggtgtcacctgattggctacttctccaag
gaaaaaatttccctgcaagcgtacaacctcgcctgcatcttgacgatgcctcaacatcaa
agaaagggatacggccgcttcctcatctccttctcgtatctcctttcgctacgagagaag
aagaagggaggaccggagcgccccctcagtgaccttggccgcctcagctacatcggctgg
tggacttggtgtctcctcacgcacatggagagcgacgcacagaagcgaaggaggaaaata
tccatcgaagatttggttcggaacacagcagtccgggaggaagatatccaaaggactctt
gaggaaatcggcgttcttcggtatgttcaaggtcaccacctgcttcttcttcacccggat
ctggtgaaaacgcggctcaaagaggcaggttcggcgggcgtattagtccacggagagaac
ctgcgcttcgtcagttaccaccggactccccctgcacctcgcgaagctctgccgccgccg
aggcggggagaagaagactga

DBGET integrated database retrieval system