KEGG   Toxoplasma gondii: TGME49_007820Help
Entry
TGME49_007820     CDS       T01093                                 

Definition
mitogen-activated protein kinase, putative (EC:2.7.11.24)
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
tgo  Toxoplasma gondii
Brite
Enzymes [BR:tgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TGME49_007820
Protein kinases [BR:tgo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   TGME49_007820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 548 aa AA seqDB search
MNTGQRPATGAMMAPGGCQAYAPCGAEGHAAYQQQPGRSYSQQYDAQHQASVRGYTSQQV
QYRNAHPSDVAATNAVQQQAAVQHHVGSQQSSSHEAAAAQQHNSGTQHTVSGSQQEGQQR
KQHHSSKPTASMPRPHSDWQIPDRYEIRHLIGTGSYGHVCEAYDKLEKRVVAIKKILRVF
EDLIDCKRILREIAILNRLNHDHVVKVLDIVIPKDVEKFDELYVVLEIADSDFKKLFRTP
VYLTELHIKTLLYNLLVGVKYVHSAGILHRDLKPANCLVNQDCSVKVCDFGLARTVDYPE
NGNSQLPISPREDDMNLVTFPHTKNLKRQLTGHVVTRWYRAPELILLQENYTEAIDVWSI
GCIFAELLNMIKENVAYHADRGPLFPGSSCFPLSPDQKAGNDFKFHTRGNRDQLNVIFNI
LGTPSEEDIEALEKEDAKRYIRIFPKREGTDLAERFPASSADAIHLLKRMLVFNPNKRIT
INECLAHPFFKEVRIAEVETNATEKVRLPFNDWMNMDEPQLRYAFVKEIQRYHPEIQLPR
RSPNRASS
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgggcaacgcccggccactggcgctatgatggcacctggcggctgccaggct
tacgctccatgcggcgccgaagggcatgccgcttaccagcaacaacctgggaggtcgtat
tcgcaacagtatgatgcccaacatcaggcatctgttcgagggtatacatcacagcaagta
cagtacagaaatgcacatccttcagatgtggcagcaacaaacgccgttcaacaacaagct
gccgtgcaacatcatgttggcagccagcagtcgagctcgcacgaagcggctgctgcacaa
cagcacaacagcggcactcaacacaccgtgtcgggctcccagcaggagggccaacaacgg
aagcagcatcactcgtcgaagcctactgccagcatgccgaggccacattcggactggcag
attccggaccgctatgaaatccgccacctaattgggaccgggtcatacggccacgtatgt
gaagcttatgataaactggagaaacgcgttgttgcgatcaagaaaatcctgcgcgttttt
gaagaccttatcgactgcaaacgcatcctgagggaaattgctattctgaacagactgaat
cacgaccatgtagtgaaggtgctcgacatcgtcatcccaaaggatgtggagaagtttgat
gagctgtacgtcgtactcgagattgcggactctgacttcaaaaagctctttcggaccccg
gtgtacctgacggaacttcacataaagacgcttctctataacctccttgtcggtgtgaag
tatgtacattctgctggcatcctgcatcgcgatttgaagcccgccaattgtctggtcaac
caagactgtagcgtgaaggtatgcgacttcggccttgctagaaccgtggactatcctgag
aacgggaactcccagctgccaatttctcctcgagaagacgacatgaatctcgtcaccttt
ccacacactaagaacctcaagcggcaacttacaggacacgtcgtgacgaggtggtatcgc
gctccggagctaattctgctgcaggagaactataccgaggccattgatgtgtggtctatc
gggtgcatctttgctgaacttcttaacatgattaaagaaaacgttgcgtatcacgcggat
cgaggtcccctcttcccaggctcgtcgtgcttccctctgtctcctgaccagaaagcgggc
aacgacttcaaatttcacacccgcggcaatcgcgaccagctcaatgttatctttaacata
ttggggactccgagtgaggaggacattgaggcgttggagaaggaggatgcgaagcgctat
attcgaattttcccgaagagagagggcacggatttggctgaacgttttccggcgtcctct
gctgacgctatccatctgctgaaaaggatgctggttttcaatccaaacaaacgcattacg
atcaatgagtgcctggcccatcccttctttaaggaagtccggatcgccgaagttgaaaca
aacgcaacagagaaggttcgcctgcctttcaatgactggatgaatatggatgagcctcaa
ctacgctatgcattcgtcaaggagatccagcggtaccatccagagattcagttgcctagg
cggtcaccaaaccgggcgagctcatag

DBGET integrated database retrieval system