KEGG   Toxoplasma gondii: TGME49_009910Help
Entry
TGME49_009910     CDS       T01093                                 

Definition
histone H2B variant 1
Orthology
K11252  
histone H2B
Organism
tgo  Toxoplasma gondii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 123 aa AA seqDB search
MSGKGPAQKSQAAKKTAGKSLGPRYRRRKRTESFALYIYKVLKQVHPETGVSKKSMSIMN
SFINDIFDRLADEAVRLIRYNKKRTLSSREIQTAVRLLLPGELSKHAVSEGTKAVTKYTT
SGA
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtcagggaaaggtccggcacagaaatctcaggcggcgaagaagaccgccgggaagtct
ctgggaccccgctaccgtcgacgaaagagaaccgagtcttttgctctgtacatttacaag
gtcctcaagcaggtgcaccctgagactggtgtgtcgaagaagagcatgagtatcatgaac
tcgttcatcaatgacatctttgatcgcttggctgatgaagcagttcgtttgatccgttac
aataaaaagaggacgttgtcttctcgggaaattcagacagctgtccgtctgctgttgccc
ggtgaactcagcaagcacgccgtctcggaaggcacgaaggcagtgaccaagtacacgact
tctggtgcatag

DBGET integrated database retrieval system