KEGG   Toxoplasma gondii: TGME49_011680Help
Entry
TGME49_011680     CDS       T01093                                 

Definition
protein disulfide isomerase (EC:2.4.1.119)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
tgo  Toxoplasma gondii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TGME49_011680
Enzymes [BR:tgo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TGME49_011680
Exosome [BR:tgo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   TGME49_011680
  Exosomal proteins of colorectal cancer cells
   TGME49_011680
  Exosomal proteins of bladder cancer cells
   TGME49_011680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 471 aa AA seqDB search
MRAGFSFALLAVGLLATAVVYSAAEEEAVTVLTASNFDDTLKNNEIVLVKFYAPWCGHCK
RMAPEYEKAAKTLKEKGSKIVLAKVDATSETDIADKQGVREYPTLTLFRKEKPEKYTGGR
TAEAIVEWIEKMTGPAVTEVEGSAEDKVTKEAPIAFVAELASKDSDMAKLFEEVANESRQ
LGRFLAKYGASDEKIYSLRYEEGTEAFTGKTKDELKKFVDTESFPLLGPINAENFRKYID
RDLDLVWLCGTEKDFDEAKTAVREAAKKLRDTRSFVWLDTDQFKGHAENALGITEFPGLV
FQSKKGRFVLPEATTSLKDAAKISQFFDDVEAGKIDRSLKSEPVPEKQDEAVKVVVGKNF
EEMVIQKDKDVMLEIYAPWCGYCKSFEPIYKEFAEKYKDVDHLVVAKMDGTANETPLEEF
SWSSFPSIFFVKAGEKTPMKFEGSRTVEGLTEFVNKHGSKPLKKDDKGEEL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcgagccgggttttcgtttgctctgttggcagtcggccttttggccactgccgtggtg
tactccgcagcggaggaggaagctgtgactgtattgactgcctctaacttcgatgacact
ctgaagaacaacgagattgtcctggtcaaattctacgcgccttggtgtggccactgcaag
aggatggcgcccgagtacgagaaggctgccaaaacactgaaggagaaggggtctaagatt
gtgttggctaaggtcgatgccaccagcgagacggacatcgccgacaaacagggtgttcgc
gaatacccaactctcaccctcttccgcaaggagaagccagagaagtacactggcggccgc
acggcggaagcaattgttgagtggatcgagaagatgaccggccccgcggtgactgaagtg
gaaggcagcgctgaggacaaggttacgaaggaggcaccgattgccttcgttgctgagctc
gcgtctaaagacagtgatatggcgaagctgttcgaggaagtcgccaacgagtcccgccag
ctgggaaggttcttggctaagtacggcgcctcggacgagaagatctactcccttcgctac
gaggagggcactgaagccttcacaggcaagaccaaggacgagctgaagaagttcgttgac
actgagtcctttcctcttcttgggcccatcaacgcggagaacttccgcaagtacatcgac
cgcgatttggaccttgtgtggctctgcggtaccgagaaggacttcgatgaggccaaaacc
gctgtccgcgaagctgccaagaaactccgtgacacccgctccttcgtctggcttgacact
gaccagttcaagggccacgctgagaacgccctgggcatcaccgaattccctggccttgtt
ttccagtccaagaagggacgcttcgtgctccctgaggcaacaacctccctgaaggacgct
gctaagatcagtcagttctttgatgatgtcgaagccggcaagatcgaccgatccctgaag
tctgagcctgtcccggagaagcaagacgaagccgtcaaggttgtcgtcggaaagaacttc
gaagagatggtcatccagaaggacaaggatgtgatgctggagatctacgccccgtggtgc
ggctactgcaagagcttcgagcccatctacaaggagttcgcagagaagtacaaggatgtc
gaccaccttgttgttgccaagatggacggcactgccaatgaaacgcctctggaggaattc
agctggtccagcttccccagcatcttcttcgtgaaggctggcgagaagacccccatgaag
ttcgagggctccagaaccgtcgaaggcttgactgagttcgtcaacaagcacggttccaag
ccgctcaagaaggacgacaagggtgaagaactgtaa

DBGET integrated database retrieval system