KEGG   Toxoplasma gondii: TGME49_013800Help
Entry
TGME49_013800     CDS       T01093                                 

Definition
protein phosphatase 2B regulatory subunit
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
tgo  Toxoplasma gondii
Brite
Protein phosphatases and associated proteins [BR:tgo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     TGME49_013800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 177 aa AA seqDB search
MGNAQGRLSPQEQMDLLHAANFSERDLKKLYKRFRALDTNQNGELDTHELFDVPELADNP
LVKRVLSIFDTNGDGKVSFVEFLVGLSKLAANTDEFQKTKFAFDVYDINKDGSISNGELF
AVMKMMVGSNLNDQQLQQLVDRTIVQADKDGDGMISFDEFREMVSHIDIADKLRVDL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgcgcagggacggctgagtcctcaggagcagatggacttgctccacgccgcg
aacttcagcgaacgcgatttgaagaaactgtacaaacgcttcagagccctcgacaccaat
cagaacggcgaactggacacccacgagctcttcgacgtccccgaacttgccgataatcct
ctggtgaagcgcgtcctgtcgatcttcgacacaaatggcgacggcaaagtgtcattcgtc
gagttcctcgtaggcctctccaagctggccgcgaacaccgacgagttccagaaaacgaag
tttgcgttcgacgtctacgacatcaacaaagacggaagcatcagtaatggcgagctgttc
gcggtcatgaaaatgatggtcgggagcaacttgaacgatcaacagctgcagcagctggtg
gaccggacaatcgtccaggcagacaaagacggcgatggaatgatttcttttgacgagttc
cgcgagatggtttctcacattgatatcgcagacaagctgagagtggatctgtga

DBGET integrated database retrieval system