KEGG   Toxoplasma gondii: TGME49_013870Help
Entry
TGME49_013870     CDS       T01093                                 

Definition
ubiquitin carboxyl-terminal hydrolase, putative (EC:3.1.2.15 1.1.1.251)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
tgo  Toxoplasma gondii
Brite
Enzymes [BR:tgo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TGME49_013870
Peptidases [BR:tgo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TGME49_013870
Exosome [BR:tgo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TGME49_013870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1090 aa AA seqDB search
MANPRPQGEATLPFSPYFGAFAETTPQDATEDLLVELRTLLGHARVATCMDTVVKTQCTY
SLDSPLSPCGLFVNLSTFLAASIDALPLDCLLAKETSGPAPARAPDAKQICPRQRLYLHV
YSKVDDEQAAKIHRQLHEAKGRGTPSDEKSQSLPPEDGTDISAEVGGEVQPHKLAINVEG
GFQIEENSGDACPEALSNTFVYSLALLPPLLTLPRTSYRSTYLSSAVDCQDSAKMQEAWE
RSVLKQVKFVKINDALPEVLRAACQALIEHRGLGGAAASTGIGAWEEELKPSRYAENLEQ
VPNPPLVGPTDWRCADCGATANLWLNLSDGYIGCGRKLYGVGGGCADGREGAAIRHFEET
GSKYPLIVKLGTITPYSADVYCYAPDEDCSVLDPKLPDHLAHFGINVQQLTKTEKSTNEL
ALDWNVRHEWSRAMEADRELLPLNGAGCVGLRNLGNTCYVNAVLQVVTSLPLIREKYVSL
LPALLASSSPSAVHSSDFLLRQSSLAAALQSPRYRLQHARRRLAILKKVAGAAPNAETVQ
TLEKKLAESKAGAGLAYLETDSVTPQLYRQMVGTLHAEFASSHQQDAEEFFSFLLQWLEE
RDREAETRVKQAREKLVSAQQGEATAQAIIAASEFSEREGACAEEALRKAKIEKLFTFAV
EQRIECAETKQVRYSYTRQQVLSLPVPLDPAVQQRYEREQREREEVDRRSKKRQKKDAPE
DDKDLEDRSSPDSTTTVSSENGEHPRNETQTRENLVGTSPGGEEASCLPPPEELPSFTFS
ECLESFLSSTLLKDFYSSATGKKGEASKQLRLASFPPYLIVQLKRFFADQHWQAKKLYCP
VLVPEELSIAESRGSGLREGEVVMPEETSASLHPSSAAAVTAFDEELLATLQSMGFSENA
CKRACLAVQSSSPDACVDWLMSHMDDAEVNNPLPSDSPSSCVNEEAVAMISSMGFTAEQA
RAGLLAVGAGGDVCSRAADWLLNHMEDLDAAVNAVLANAEKPREEEMEDVSTLSPLERVT
RDLDDEPTGLYKLHGFITHMGVNANSGHYVCHVKRDGKLVLFNDEKVAEAVEPPIDLGYI
YVFRRADVPE
NT seq 3273 nt NT seq  +upstreamnt  +downstreamnt
atggccaatccacgtccccaaggggaggcaactctcccgttttccccgtactttggcgca
tttgcggaaacgacgcctcaagatgccactgaggatcttctggtggaactgcggactcta
ctgggacacgcgcgcgtggcgacttgcatggacacggttgtcaaaacgcagtgtacatac
agcttggacagtccgttgtcgccgtgcggcctctttgtgaacttgtcgacgttcctcgcg
gcttcgatcgacgcgcttcccctggactgcctgcttgccaaagaaaccagcgggccggcc
ccggctcgcgccccggatgccaagcaaatctgcccgcgacagcgcttgtatctccacgtg
tattcgaaagttgacgacgaacaagccgcgaaaatacaccgacaactgcatgaggcgaag
gggcgtggaacgccctccgatgagaagagccagtctctccccccagaggacggaacagat
atcagcgctgaagttgggggagaggtgcaaccgcacaaactcgcaatcaacgtcgaggga
ggtttccagatagaagagaacagcggagacgcatgtcctgaggctcttagcaacacgttc
gtatactcgcttgctctgctcccgcctctgctgacgctccctcgcacgagctatcgctct
acgtacctttcatcggccgtggattgccaagactctgcaaagatgcaagaagcctgggag
aggagtgtgctgaagcaagtgaagttcgtgaagatcaacgacgcactcccagaagtcctg
cgagcagcttgccaggctctcatcgaacaccgcggcctcggtggcgccgcagcctcgaca
ggcatcggtgcctgggaagaagaactgaagccaagtcgctacgcagaaaatctggagcag
gtgccgaacccgcctctggtcgggcctactgactggcgttgtgcagattgcggggcgacc
gccaatctgtggctgaatctgtctgacgggtatattggatgcggccgaaaactgtacggc
gtgggagggggctgtgcagacggacgcgaaggagctgccatacgtcacttcgaggaaact
ggtagcaagtatccgttgattgtgaagctgggaacgatcactccttactccgctgatgtt
tactgctacgcgcccgacgaggattgttccgtcttggatccgaagcttcctgatcatctc
gctcacttcggcattaatgtccagcagctgacgaagacggagaagagcacaaatgaactg
gcgctcgactggaatgttcgccacgagtggtcgcgcgccatggaggccgaccgcgagctt
cttcctcttaacggcgctggctgtgtggggctccgaaatttaggaaatacgtgctatgtc
aacgccgttctccaggttgtgacgtccctcccgttgatcagggagaagtacgtgtctctt
ctgcctgctcttctcgcgtcttcgtctccgtctgcggtacactcttcggacttccttctg
cgacaaagttctctcgccgccgcattgcagtctccacgctatcgactgcagcatgcacgg
aggcggctcgcgattctgaaaaaagttgcaggcgctgcaccaaacgcagaaacggtgcag
acacttgagaaaaaactcgcagagtcgaaggctggagctggtctggcgtatctggagacg
gacagcgtgacgcctcagctgtacagacagatggtggggacactgcacgcagagttcgcg
tcttcacatcagcaagacgcagaagagtttttctcgttcctgctccagtggctggaagag
cgagaccgggaggcggagacgcgtgtgaaacaggcgagagaaaaactggtttccgcgcag
caaggagaggctacagcccaagccatcatcgcggcgtcggagttctcagagcgcgagggt
gcctgcgccgaggaggcgctgaggaaagcaaaaatcgagaaactcttcaccttcgctgtc
gagcagaggatcgaatgcgcagaaacgaagcaagtccggtactcgtacactcgccagcag
gttctgtcgttgcctgttcccctcgaccctgcagttcagcaacgctatgagagagagcag
cgcgaacgcgaagaggtggaccgtcgttcgaagaagagacagaagaaggacgcgccggaa
gacgacaaagacctcgaggaccgatcttctcccgactccaccaccactgtcagcagtgaa
aacggggaacacccgaggaacgaaacacagacacgagagaacttggtcgggacatcgcct
ggaggcgaggaagcgtcgtgcctgcctcctcccgaggagcttccttcgttcactttttcc
gagtgtctcgagagctttctttcttctacacttttgaaggatttctactcttctgcgaca
gggaagaaaggcgaggcatctaaacagctgcgactggcctcctttcctccctacttgatt
gttcaactcaagcgcttctttgcggatcaacactggcaagcgaagaagctctattgtcct
gtcttggtccccgaagaattgagcatagcggagtcgcggggctccggactcagagagggc
gaggtagtgatgccggaagagacaagtgcctcgcttcatccttcctctgcagcagcggtc
actgccttcgacgaagaacttttagccactcttcagtcaatgggattctccgaaaacgcc
tgcaagcgcgcgtgtctagctgtccagagcagcagtccggatgcctgcgtggactggttg
atgtctcacatggacgacgcggaggtgaacaatccactgccttcggactctccgtcatcc
tgtgtgaacgaggaagctgtcgcgatgatttcttcgatgggattcactgcagagcaggcc
agagcggggctcctcgcggtgggtgccggcggggacgtttgctcgcgagcagccgactgg
ctgttgaatcacatggaggacttggacgcagctgtgaacgccgtgttagcgaatgccgag
aagccgcgggaagaagaaatggaggacgtctcgactctgtcaccgctggaaagagttacg
cgagacctagacgacgagccgacggggctgtacaaactccatggattcatcacgcacatg
ggcgtcaacgcaaattccggtcactacgtctgccacgtgaagcgcgacgggaagctggtg
cttttcaacgacgagaaagtcgcagaagccgtcgaacctccgatcgacctcggatacatt
tacgtttttcgccgtgcggatgtacccgagtag

DBGET integrated database retrieval system