KEGG   Toxoplasma gondii: TGME49_014520Help
Entry
TGME49_014520     CDS       T01093                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
tgo  Toxoplasma gondii
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    TGME49_014520
  Replication and repair
   03420 Nucleotide excision repair
    TGME49_014520
Transcription machinery [BR:tgo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     TGME49_014520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 836 aa AA seqDB search
MSHICPFFLDAACIYTRVIAYIGNLNGGCSRVCQRWRFPVVCVAHRAPTLWLPSQHLGLR
AADFSSRCSVSLCISPASLRLACCSIGLYDYIFSLPAAIRHYLFSFTPGCVACFASLCEL
DRLIVLRLLFIQQHVSERAMRLWVAPGSAADLRRSLQRLVSPCRMLVTSVQDSPSRHGAA
DKARASSGHPADARAASPPHQPSSSGRQGSHQAQHLTTQYSLAAPLKQTLLQYVLGGPSR
PAAPFLRVPAEGSFQFPTKSQLVNHSRKQWDALLRFIVEGERGSFACSEERGGAAREAEA
EETRTKGDDRGHTADGQHLGTGKKRRKSDKLSTPGPCEDLVKAAYGGPPSPTAPTSAAAM
SREAFSWILKDLKSQVNSLVVEFLFLLDGGVLTNAAHDAGGRSSGPNSAPASGGSDREKS
SSCGKRQAVGQAGAPHRAGELSKEDNREGGSANRIEAATNDMKEVLLLILALGQSSVGQP
ISVRHLSSAQRRFITFAINIGLVWAPPTSAAFVLAAPYALLLRPDKGGYSFSGTGAAGGG
PGAQGTPGFATPSQPGASRGPPGPAGSQGQGMHCPAGLSGGKLQEGGGEAESLSVLDVTF
FPLVRDDDVCDPARLNHSSRSPDSSSLLLSFSTSSVSSSPLSMMGMEAGMLVQSNFKVYV
YTASALQLSVLSHLCELQARMPNLIVGILTRASVLAAYKSGITADQIIRFLEAHAHPVVL
ERKLRTNAPLLPENVTIQLRMWEAERMRLSLYPAVLLKKWDAQFMPELFQRSVRWAVGKN
FAIYFTPWPEDPNSEEFREWMQKEKYLAIHADYKPEMVEKIRDVRDSIIKQQAGKA
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacatctgtcctttctttttggatgccgcctgtatatatacacgcgtcattgcg
tatatcgggaacttgaacggtggctgttcgcgtgtgtgtcagcgatggaggtttcccgtt
gtctgtgtggctcaccgtgcccccacactttggcttccttctcagcatctgggcttgcgt
gcggctgacttctcgtctaggtgctccgtctctctctgtatctctcctgcttccctccgt
ctggcttgctgcagcattggcctgtacgactacatcttctctttgcctgcggcgattcgg
cattacctcttctccttcacgccggggtgcgtggcatgtttcgcgtcgctgtgcgagctg
gacagactgatcgtcttgcgtctcctctttattcagcagcatgtgagcgagagagcgatg
cggctttgggtcgcgcccggcagcgccgccgacctccgccgttctcttcagcgcctcgtc
tctccttgtcgcatgctggtcacttccgtccaggactcgccgtccagacacggcgctgcc
gataaagcacgcgcttcctcagggcaccccgccgacgcccgcgctgcctcgccacctcac
caaccgtcttcttcgggacgccaggggagccaccaggctcagcacttgacgacgcagtac
tcgctcgcggcgcctctgaagcagacgcttctgcagtacgttttgggcgggccttcgcgc
ccggcggcgccgttcctcagagtccctgcagaggggagcttccagttcccgacgaagagc
cagctggtcaaccacagcagaaagcagtgggacgccctgctgcggtttatagtcgagggc
gagcgcggctcgttcgcatgcagcgaggagcgaggcggcgccgcgagggaagccgaggcc
gaagagactcgcacaaagggcgacgaccgaggacacacggcagacgggcagcatctggga
actggaaaaaaacgaaggaaatcagacaagctctctaccccagggccttgcgaagatctc
gtcaaggctgcctacggaggcccgccgtcgccgacggcgccgacctcggcggctgcgatg
tcccgcgaagccttttcgtggattttgaaagatctgaagtcgcaggtcaactctctggtc
gtcgagtttctttttcttctcgacggcggagtcctcacaaacgccgcccacgatgcaggc
ggccgcagcagtggcccaaactctgcgcctgcctctggaggctcagacagagagaaaagc
agcagctgcgggaagcgacaggctgtgggccaggctggcgctccgcacagggcgggggag
ctctcgaaagaagacaacagagagggcggatcagcaaatcgaattgaagccgccactaac
gatatgaaagaagttcttctgttgattcttgcgctgggtcagtcgtctgtgggccagccg
atctctgtgcggcatttgtcgtctgctcaacggcgctttatcactttcgccataaacatt
ggcctcgtctgggcgcctcccacttccgctgcgtttgttttggcggcgccgtacgccctt
cttcttcgtccagacaaaggcggatacagcttctccggtacgggcgcagcaggcggaggg
cctggagcccaagggacaccaggcttcgcgaccccctcacagccgggcgcttcgcgaggc
ccgccaggtccagctggttcgcaggggcagggcatgcactgcccggcgggccttagcggc
gggaaacttcaggagggcggcggggaggcagaatcgctttctgttctggatgtcaccttt
ttccctctcgttcgcgacgacgacgtatgcgaccccgcacggcttaatcattcgtcaagg
tcacccgactcttcatcgcttctgcttagcttttcgacgtcatctgtctcttcgtctccg
ctctccatgatgggcatggaggcaggcatgcttgtgcagagcaacttcaaggtgtacgtg
tacaccgcatcggcgttgcagttgtccgttctgtctcatctctgtgagcttcaagcccgc
atgccgaatctcattgtgggcattctcactcgagcgtccgtgctcgctgcgtacaagagc
gggataacagcggaccagatcattcgatttcttgaggcccacgcccaccctgttgtgttg
gagaggaaactgcgcacgaacgctccactgctgccggaaaacgtgacgatacagctgcgg
atgtgggaggccgaacgcatgcgcctctcgctgtatcctgcggtgcttctgaaaaaatgg
gacgctcaattcatgcctgaactctttcagagaagtgtccggtgggccgtaggcaaaaat
tttgccatctatttcactccctggccggaagacccaaacagtgaggaattccgggagtgg
atgcagaaggaaaagtaccttgccatccacgccgactacaaacccgagatggtggaaaaa
atacgcgacgttagagactccatcatcaagcagcaggctggaaaagcgtga

DBGET integrated database retrieval system