KEGG   Toxoplasma gondii: TGME49_014850Help
Entry
TGME49_014850     CDS       T01093                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase, putative (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tgo  Toxoplasma gondii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TGME49_014850
Enzymes [BR:tgo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     TGME49_014850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 513 aa AA seqDB search
MLKSPVFIFSDISSAAVSPVSALDRRLLLDANSCRELLRRTEEDPVSSLVSSPASLAPPA
SPPSTRVKRLVVLGSTGSIGKSTLEIAREFPDIFQIVGLAAGGSNLALLAEQVAAFRPQY
VYLGDSSKVAELQERLNDHERSAAFPRPRLLLGDEGLAELACVPNYDILVSAIVGFKGVL
PTLKALEAGKDVALANKEALVAAGPVFRCLLSTRGLLYGDQERQDRHERSHRSGDQEGDR
EEDTDGDRREECDKRRAKAGQKCGLLLPVDSEHSAIFQALQGVPASCYPPRKLLLTASGG
PFRGRTRDELEQVTLESALKHPKWSMGAKITIDSATLMNKGLEVIEAHFAFGCPYSSIEV
LVHPQAVIHSAVELRDGATLAQLGLPDMKLPIAYALTWPHRLAAPWSAGVDLTREGNLTF
EKPDLNTFGCLGLAYEAGERGGVAPACLNAANEVAVERFRNKEIGFVDIEDTVRHVMALQ
ERERDNFSDVSLQDVFDADHWARTAARAFKPRK
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagtctccggtcttcattttctctgacatttcttctgctgcggtgtctcccgtg
tctgccctcgatcgtcgtctgcttctcgacgcaaactcgtgcagagaactcttgcgacgt
accgaagaagaccctgtctcctcgcttgtctcctcgcctgcgtctctcgcgcctccggct
tcgcctccctccacgcgtgtgaagagacttgtggttttgggaagcactggcagcatcggg
aagagcacattggagatcgccagagagtttcctgatatatttcaaattgttggcctcgca
gccgggggctccaatctcgctcttctcgccgagcaagtggctgctttcaggccacagtac
gtgtatctcggagactcttccaaggtggcagagctccaagagaggctgaacgatcatgag
agaagcgctgcttttcctcggccccgtcttctcttgggcgacgagggccttgcagagctt
gcatgcgtccccaactacgatattcttgtctccgctattgtcggcttcaaaggagttctc
cccacactgaaggccctcgaggcaggcaaggacgtggcactagcgaataaagaggccctg
gtcgcggcaggccccgttttccgctgtctcctctccacgcgcggtctgctctacggggat
caagagaggcaagacaggcacgagagatcgcacagaagcggagaccaagaaggagacaga
gaagaagacacagacggagacagaagggaggaatgcgacaagaggcgcgcgaaggcaggg
cagaaatgcggcctccttcttcctgtcgactccgaacactcggcaatctttcaggcgctt
caaggtgtgccggcctcttgctacccccctcggaagctgcttctgactgctagtggggga
cccttccgaggccggacgcgagacgaactggagcaagtaactcttgaaagtgctctcaaa
catcccaagtggagcatgggcgcgaaaatcacaatcgacagcgcgacgttgatgaacaag
ggcctggaagtcattgaagctcacttcgccttcgggtgtccatactcctccatcgaggtc
cttgttcacccccaagctgtcatccactctgcagttgaactacgagatggcgccacgctc
gcccagcttggcctccctgacatgaagctgcccatcgcctacgccctcacttggcctcat
cggcttgccgcaccgtggtcggcaggcgtcgacctgacccgggaaggcaatctgacgttc
gagaagcccgacttaaacacatttgggtgtctaggcctcgcctacgaggcaggcgaacga
ggaggcgtggcgccggcttgcttgaatgcggcaaacgaagtagctgttgagagattccgc
aacaaagaaatcgggttcgtggacatcgaggacaccgttcgccacgtcatggctttgcag
gagagagaacgggacaacttctcagacgtctctctacaggatgtcttcgacgctgatcac
tgggctcgcacagcagcgagggcctttaagccgaggaagtga

DBGET integrated database retrieval system