KEGG   Toxoplasma gondii: TGME49_019550Help
Entry
TGME49_019550     CDS       T01093                                 

Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutaratedehydrogenase complex, putative (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tgo  Toxoplasma gondii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TGME49_019550
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TGME49_019550
  Amino acid metabolism
   00310 Lysine degradation
    TGME49_019550
Enzymes [BR:tgo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TGME49_019550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 470 aa AA seqDB search
MPVLAAAAAASRRGLSSLLLPVECRPRFSAGVSSAVQAGKKVCSIKSAFSAVARHRSRPL
ASLSSLATPSLAFRDARWTSVTSRCFSSAAGAETVVPVPSMGDSITEGSLNEWKKQPGEY
VKEGELVAVIDTDKVSVDINAPQAGRIVRFEANAGDTVEVGKPLYVIDPTAQPDPAELAA
AAAAAAAPATPVKTEAAKPVSPPEKSSVPQPAPSVSPPKPAPAPKKPASPVVAVQSPGRE
EKRVPMSRMRQRIAERLKGAQNTAAMLTTFNECDMGALMAMRSELNPAFQERHGVKMGFV
SAFMLASAMAMKKVPEVNAFIEGNEIVYKSHVDISVAVATPTGLMVPVVRDCERKSWPEL
EKELAHLAVKARNNQIALEDMAGGTFTISNGGVYGSMMGTPILNPPQSSILGMHGITKRA
VVKNDQVVIRPMMYLALTYDHRLIDGREAVTFLCHIRDYIEDPRLMLLDL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgccggtccttgctgcagcggcagccgcgtcgcgacgggggctctcgtccctgctgctg
cctgtggaatgccgaccgcgtttctccgccggcgtctcaagcgcagtgcaagcaggaaag
aaagtgtgttcgatcaaaagcgccttttcagcggtcgccagacatagaagtcgccctctc
gcttctctgtcgtctctcgccactccgagcttggcttttcgtgatgctcgctggacgtcc
gtcacctctcgctgcttctcgtctgcggccggcgcggagacggttgttccggtcccgtcc
atgggagactcgattacggaggggagcttgaacgagtggaagaagcagccgggagagtac
gtcaaagaaggggaactcgtcgccgtcatcgatacggacaaggtgtcagtcgacatcaac
gcaccgcaggcgggcagaatcgtcagattcgaggcaaacgcaggagacacggtagaggtt
ggaaagccgctctacgtgatcgacccaactgcgcaacctgatcccgcagaactcgccgct
gctgctgccgctgcagccgcccccgccactcctgtgaaaacggaagcagcgaaacctgtt
tcgcctccagaaaagtcaagcgttcctcagcctgctccgagtgtatctccaccgaagccg
gcgccggcgcccaagaagcctgcaagccccgtcgtcgctgtgcagagtcctggaagagag
gaaaagagagtgccaatgagccgcatgcgtcagaggattgcagagcggctgaagggtgca
caaaacacagcagccatgctgacgacgtttaatgaatgcgacatgggagctctcatggcg
atgagaagcgaattgaatccggcattccaggaacgtcacggagttaaaatgggctttgtc
tcggccttcatgctcgcgagcgccatggcgatgaagaaggttccagaggtcaacgcgttc
attgaaggcaacgagattgtttacaaaagccatgtggacatcagcgtcgcggtggcgact
ccgacaggtttgatggttcccgtcgttcgagactgcgagaggaaatcgtggccagaactt
gaaaaggagcttgcacatcttgccgtgaaggcacgcaacaaccagatcgctctggaagac
atggcgggtggcaccttcaccatctcgaacggcggcgtgtacggcagcatgatgggtact
cccatcttaaatcctccacagtcttcgattctcggcatgcacggcatcacaaagagagct
gttgtgaagaacgaccaagttgtcattcgcccgatgatgtacctggccctgacgtacgac
caccgactcatcgacggcagggaggcggtgacatttttgtgtcatattcgcgactacatc
gaggacccgcgcttgatgcttcttgacctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system