KEGG   Toxoplasma gondii: TGME49_019550Help
Entry
TGME49_019550     CDS       T01093                                 

Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutaratedehydrogenase complex, putative (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tgo  Toxoplasma gondii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tgo01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tgo00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:tgo00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 470 aa AA seqDB search
MPVLAAAAAASRRGLSSLLLPVECRPRFSAGVSSAVQAGKKVCSIKSAFSAVARHRSRPL
ASLSSLATPSLAFRDARWTSVTSRCFSSAAGAETVVPVPSMGDSITEGSLNEWKKQPGEY
VKEGELVAVIDTDKVSVDINAPQAGRIVRFEANAGDTVEVGKPLYVIDPTAQPDPAELAA
AAAAAAAPATPVKTEAAKPVSPPEKSSVPQPAPSVSPPKPAPAPKKPASPVVAVQSPGRE
EKRVPMSRMRQRIAERLKGAQNTAAMLTTFNECDMGALMAMRSELNPAFQERHGVKMGFV
SAFMLASAMAMKKVPEVNAFIEGNEIVYKSHVDISVAVATPTGLMVPVVRDCERKSWPEL
EKELAHLAVKARNNQIALEDMAGGTFTISNGGVYGSMMGTPILNPPQSSILGMHGITKRA
VVKNDQVVIRPMMYLALTYDHRLIDGREAVTFLCHIRDYIEDPRLMLLDL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgccggtccttgctgcagcggcagccgcgtcgcgacgggggctctcgtccctgctgctg
cctgtggaatgccgaccgcgtttctccgccggcgtctcaagcgcagtgcaagcaggaaag
aaagtgtgttcgatcaaaagcgccttttcagcggtcgccagacatagaagtcgccctctc
gcttctctgtcgtctctcgccactccgagcttggcttttcgtgatgctcgctggacgtcc
gtcacctctcgctgcttctcgtctgcggccggcgcggagacggttgttccggtcccgtcc
atgggagactcgattacggaggggagcttgaacgagtggaagaagcagccgggagagtac
gtcaaagaaggggaactcgtcgccgtcatcgatacggacaaggtgtcagtcgacatcaac
gcaccgcaggcgggcagaatcgtcagattcgaggcaaacgcaggagacacggtagaggtt
ggaaagccgctctacgtgatcgacccaactgcgcaacctgatcccgcagaactcgccgct
gctgctgccgctgcagccgcccccgccactcctgtgaaaacggaagcagcgaaacctgtt
tcgcctccagaaaagtcaagcgttcctcagcctgctccgagtgtatctccaccgaagccg
gcgccggcgcccaagaagcctgcaagccccgtcgtcgctgtgcagagtcctggaagagag
gaaaagagagtgccaatgagccgcatgcgtcagaggattgcagagcggctgaagggtgca
caaaacacagcagccatgctgacgacgtttaatgaatgcgacatgggagctctcatggcg
atgagaagcgaattgaatccggcattccaggaacgtcacggagttaaaatgggctttgtc
tcggccttcatgctcgcgagcgccatggcgatgaagaaggttccagaggtcaacgcgttc
attgaaggcaacgagattgtttacaaaagccatgtggacatcagcgtcgcggtggcgact
ccgacaggtttgatggttcccgtcgttcgagactgcgagaggaaatcgtggccagaactt
gaaaaggagcttgcacatcttgccgtgaaggcacgcaacaaccagatcgctctggaagac
atggcgggtggcaccttcaccatctcgaacggcggcgtgtacggcagcatgatgggtact
cccatcttaaatcctccacagtcttcgattctcggcatgcacggcatcacaaagagagct
gttgtgaagaacgaccaagttgtcattcgcccgatgatgtacctggccctgacgtacgac
caccgactcatcgacggcagggaggcggtgacatttttgtgtcatattcgcgactacatc
gaggacccgcgcttgatgcttcttgacctctga

DBGET integrated database retrieval system