KEGG   Toxoplasma gondii: TGME49_019630Help
Entry
TGME49_019630     CDS       T01093                                 

Definition
NADPH-cytochrome p450 reductase, putative (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
tgo  Toxoplasma gondii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 949 aa AA seqDB search
MSGFFTETPGRLLLLSGVALGTAAALYVLLRPPKKIRRCGRDAASPRSQTRAGASAGEAE
ERSADPLGDGNVKKLSCRDTLFVYFGSQSGTAEAFSEELASAVVQDIEELQHVEVVDLED
FDPDAFLAQQFKVLVLATHGEGEPTDNARGFFEWLQRYTKDLREGRTPSPAMQGWCAVFG
LGSSDYERFNRMGRRTFKMLEFIEKRQRELHASSSSSLLRLLCPLGVGDAAKALDADFAL
WRQAHFLPALKRIADPTALQEETMRTTPEVRGDAPVSPVSYPPLSGVCTPEASTASTPEL
DADPQRRGDSSPLQGYHAARSAESLEQETREDLSRFSSAASLANAQHNAQSVTAAVERLE
KRVASWAKRGEEAPFRLMVGPSRERLLAEQRRLEEEAAGRAGKSLPSLPSLLAQAPHGTS
AKLFFQMHALPVNSVRQLRQQVTFSSASAAGSHCAHRVAASETEKEPGEPWRTDAPQEST
VEVELDLTDCPAVQYRAADNMYCLHKNTAEEITWWHTFLGFKEQGVALNDFVHWVPSRAA
LASAFPVSSSSSSPSSSPALSYAVPFPTPCTVEEALGFFSNLTGQLPKFAAACLSLWIED
PEERTQWLRLFCDEPAAQQAYEACVRSPLLSLRELLPLLAPSFSRPRLPRLSSSSALDED
EEAASTQELGLILSLLAAAHAPRAYTIASSPKALARETGTRSVALCVGLVAEQRESLAIT
TARLEEHGFKIFGSSSAVRSARRGPLFHQEDRLFFGACSSFITQQLRPGDVLKALIKPSS
FRLPADVKRPIIMVAAGTGIAPFIAFLREFACLGGWLAPVVLFFGCQRANKDFLYREELL
RYKARQDAAEESQGKKHFLTHLFLAFSREPGQPKTYVQHKIAEQRNLVLQLLQEQQATLY
ICGRTAMAAGVTKTLAHAAAETLGGDEARGNAFVHDLRKSRRIVEEVWA
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcttcttcactgagactccaggccggctcctcctgctttctggagtcgccctg
gggacagccgctgcgctgtacgtgctcctgagacctccaaagaagatccggagatgcggc
cgagacgctgcttcccctcgttcgcagacgcgcgccggcgcctcagcaggcgaagctgaa
gagcgaagcgcggatcctttgggcgacggaaacgtcaagaagctcagctgcagagacaca
ctcttcgtctacttcgggagtcagtcgggaacggcggaggccttcagcgaggaactcgcc
agcgcagtcgttcaagacatcgaagaactccaacatgtcgaggtcgtcgatctcgaagac
ttcgacccagatgccttcctggcgcagcaattcaaagttctcgttctggccactcacgga
gaaggcgagcctacagacaatgcacgcggcttcttcgaatggcttcaaaggtacacgaaa
gatctgcgagaagggaggacgccttctccggcgatgcaaggctggtgcgccgtgtttggg
ctcggcagcagcgactacgaacggttcaaccgcatgggccgccgaaccttcaagatgttg
gagttcattgaaaagcgacaaagggaactgcatgcgtcatcgtcctcttcgcttctacgt
ctgctctgccccctcggagtgggagacgcagcgaaggcccttgacgcggacttcgccctg
tggaggcaagcccactttctccctgctctgaaacgcattgcagatccaacggctctccaa
gaagaaacgatgagaacgaccccagaagtccgcggcgacgcccccgtctcgccggtctcc
tacccgccgctgtcaggtgtatgtacacctgaggcgtcgactgcgtcaactccggagctc
gacgcagaccctcagcggcgaggcgattcttctcctctccaaggctaccatgcagcacgc
tcagcggaaagtctcgaacaggagacaagggaagacttgtcgcggttctcctctgcggca
tcattggcgaacgcacaacacaacgcccagtcggtgacagctgcagtggagcgactcgag
aagcgggtcgcctcttgggcgaaacgcggtgaagaagccccgtttcgcctcatggtcgga
ccttctcgcgagcgtctattggctgagcagcggcgcctcgaagaagaagccgctgggcgc
gccgggaagtcgttgccttccttgccttccttgctcgcccaggcgcctcatggcaccagc
gcaaagctcttcttccaaatgcatgcgctgcctgtaaacagcgtccgacaactccgtcag
caagtcaccttctcctccgcttctgccgcagggtcgcactgtgcgcaccgtgttgccgcc
agcgaaacagagaaggaaccgggcgaaccgtggagaaccgacgcgccacaagaaagtact
gttgaagtcgaactcgacctcacagactgccccgctgtacagtaccgtgcagcagacaac
atgtactgcttgcataaaaataccgccgaagagatcacctggtggcacacattcctcgga
ttcaaggaacaaggcgtcgctctcaacgatttcgttcactgggtccccagccgggctgcc
cttgcgtctgcctttcctgtttcctcttcgtcttcgtcgccttcttcttctcctgctttg
agctacgctgttcccttcccaactccatgcacagttgaggaagcgctgggatttttctcc
aacttgaccggccaactcccgaagttcgccgcagcctgtctctcgctgtggatcgaagac
cctgaggaacgaacccagtggctgcgcctgttctgcgacgagcctgctgcgcagcaggcg
tacgaagcctgcgtgaggtcacctctcctttcgctgcgcgaacttcttccgctgcttgcg
ccttccttttcgcgccctcgtctccctcgtctttcgtcttcctccgcgcttgacgaggac
gaggaagcggcttcaactcaagaactgggtttaattctctctctcctcgccgccgcgcat
gcaccgcgggcgtacactattgcctcgtcgccgaaggcgctcgcgagagagacagggacg
cgatcagtcgccttgtgtgtgggcctggtggctgagcagagagagagtctggcgatcacc
acggcgcgtctagaagaacatggtttcaagattttcggcagttcttcggctgtgcgttcc
gcgcgacgcgggccgctttttcatcaggaagatcgcctcttcttcggagcttgttcgtcg
tttattacacagcaactgcgtccgggagatgtgttgaaagcgctcatcaaaccttcgtct
tttcgactccctgccgacgtaaaaaggcccatcatcatggtggcagcagggacaggcatc
gccccgttcatcgcctttctccgcgagttcgcctgcctcggcggttggctggcaccagtc
gttcttttctttggatgccagcgagcaaacaaagacttcctctatcgcgaggaactgctg
cggtacaaagcccggcaggacgcagctgaagaatctcagggaaagaagcacttcctgact
caccttttccttgcgttctcgcgcgagccgggacaaccgaagacgtacgtccagcacaaa
atcgccgaacagcggaacttggtgctgcaactgttgcaagagcagcaggcaacgttgtac
atttgtggccggacggcaatggcagcaggcgtgacgaagactctcgcgcacgcagcggcg
gaaacgttggggggcgacgaagcgcgaggcaacgcattcgtacatgatctccgaaaaagc
cgacgaatcgtggaggaggtctgggcgtag

DBGET integrated database retrieval system