KEGG   Toxoplasma gondii: TGME49_019750Help
Entry
TGME49_019750     CDS       T01093                                 

Definition
cytochrome c, putative
Orthology
K08738  
cytochrome c
Organism
tgo  Toxoplasma gondii
Pathway
Sulfur metabolism
Metabolic pathways
Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    TGME49_019750
 Human Diseases
  Infectious diseases
   05145 Toxoplasmosis
    TGME49_019750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 115 aa AA seqDB search
MSRAEPDVQVPSGDIKAGAKVFKAKCSQCHTINAGGAAKAGPNLHGFIGRESGKADFPYS
DANKTSGIIWSEKHLWEYLLNPKTYIPGTKMVFAGIKKEKERADLIAYLVDASNK
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtgctgaacctgacgtccaagtgccgtctggcgacatcaaagccggcgcgaaa
gttttcaaagccaaatgctcgcaatgccacaccatcaacgctgggggtgctgccaaggcc
ggaccgaacctccacggtttcatcggccgtgaaagtggaaaagctgacttcccgtactcg
gatgccaacaagaccagtggcattatctggtccgagaagcacttgtgggagtacttgttg
aacccgaagacgtacattccgggcacgaagatggtgtttgcgggtatcaagaaggagaag
gaacgcgcggatctgattgcgtaccttgttgatgcctccaacaaatga

DBGET integrated database retrieval system