KEGG   Toxoplasma gondii: TGME49_020840Help
Entry
TGME49_020840     CDS       T01093                                 

Definition
threonine synthase, putative (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tgo  Toxoplasma gondii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tgo01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tgo00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:tgo00750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 686 aa AA seqDB search
MKFISSRGSKKQYSFVEAALAGLADDGGLLMPEYIPTVNAELQNNWSSLSFPELCAEVLA
LFVDQKENNGAPEELRSSLRTMTMQCFSVFNHPDVITIKKLKLCSSADVERSGVPRTELY
SQALSTEQRGMSQHQQDHNWNGGGMHPYLLELFHGPTFAFKDIAMQLIAFLQRKQTQTPP
SGLIVLAATSGDTGSAAIAALKSRSPLIHVVVLFPKGRTSEIQRLQMVTVQDPNIHCLQV
NEGMKSKTLRHGCFRIPTSPGKNAITPVNGQPSRDGIRDSTQTTTSASAVDGFPECRIAW
KLSVVNSINCVRILIQAAYWWYSALKMQHEYNSKTGTAPEMYGTKTASRRRCNIVVPTGN
FGNIFSAFLAKQMGAPIGKLLLATNTNDVLCQAQDTGVYDKRRGVRATCSPSMDIAAASN
FERLIFCSCGTQGNMPQIELTDEQRTQDLTQKQGRSLWEKSSLPAESQNKVPEHCLMGDA
NTPEDKRFESTSEERFRSSGPWSSTLRAVTERFDQDGYARLGDKFLSFYRNNFLTEAVDD
AETTKAIEKMYRLYGEIVDPHTAVGYAAYLKQVSKLPGESQGFSSGSNNEGGQKDATPTS
SDPWLLAATAHFGKFPETVLAVVGRDKVNLIPLELKKLKDMPQRFAEIGPSADSLKSFIV
EKFTSSNKQMLGIDSATMDGRRNEIK
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcattagttctagaggaagtaagaagcaatacagcttcgtcgaagcggcgctc
gcaggactcgccgacgatggaggcttactcatgcctgaatacatccccacagtaaatgcg
gaattacaaaacaactggagttccttatcgtttccagaattatgcgccgaagtcctcgcg
cttttcgttgaccaaaaagaaaacaatggtgcccctgaagaactccggagttctttgcgt
acaatgacaatgcaatgcttctcggttttcaaccaccctgatgtcataacgatcaagaaa
ttgaagctgtgctcctctgcggacgtggagaggtcaggggtaccgcgaacggaactgtat
tcacaggcactcagcactgagcaaagaggaatgtcacaacatcaacaagaccacaattgg
aatggaggtggaatgcatccctacctactggagctttttcatggacctacattcgctttc
aaggacattgcaatgcaactcatagcctttcttcagcggaagcagacgcaaacgccaccc
tctggtttgattgttctagcggcgacgagcggggacaccggaagcgcagcgattgcagca
ttgaagagcaggtcgccgttgattcacgtagtggttctgttcccaaaaggtcgcacctcc
gaaattcagcggctgcagatggtgactgtacaggacccaaacattcactgtcttcaggtc
aacgaagggatgaagagcaaaaccctcaggcacggttgcttccgcattcccacttctccg
gggaagaacgcaattacccctgtcaacggtcaaccttctcgtgacggaattcgagacagc
acacagactactacatcagcatcagcagtggacgggttccctgaatgccgaatagcatgg
aaactttcagtggtgaatagtatcaactgcgttcgaatccttattcaggcagcatactgg
tggtattccgctctaaagatgcaacacgaatataacagcaaaaccggcaccgctcccgaa
atgtacggtacaaaaactgcgagtagacgtcgctgcaacattgtcgtcccgactggcaat
tttggaaacattttctccgccttccttgcaaaacagatgggtgcgccaatcggcaaactt
ttgctggcgacaaacacgaacgacgtgctctgccaagctcaggacactggagtttatgac
aagcgacgaggagtccgggcgacgtgcagcccgtcaatggatattgctgccgcaagcaac
tttgagaggctcattttctgcagctgcgggacccaagggaacatgcctcagatagagctg
acagacgaacaacgaactcaagatctaacacagaagcaagggcgtagcctatgggagaaa
tcgtcacttccagctgagtcccagaacaaggtgccagaacactgcctgatgggagacgct
aacacaccagaagataaacgatttgaaagcacatccgaggaacggttccgcagttcggga
ccctggtctagcacactcagagccgtgacggagagattcgatcaagacggttatgctcgg
ctaggtgacaagtttctaagcttttataggaacaattttctcactgaggctgttgatgat
gccgagacgacaaaagccatcgaaaaaatgtatcgtctctatggagaaattgtggaccct
catacggccgtagggtatgcagcgtacctgaagcaggtatcgaagctccctggggagtct
caaggtttctccagtgggtcaaataacgaaggcggacagaaggatgctacgcccacaagc
agtgacccatggctcctggcagcgactgctcatttcggcaaatttccagagacagtcctg
gcagttgtcggtcgcgacaaagtgaatctcattccattggagctgaagaagctgaaggat
atgccgcaacgtttcgccgagatcggcccatctgcggacagtttgaagagcttcatcgtc
gagaagttcacttcatccaacaagcaaatgcttggcatagattctgctaccatggatggc
agacgcaatgagatcaagtag

DBGET integrated database retrieval system