KEGG   Toxoplasma gondii: TGME49_021320Help
Entry
TGME49_021320     CDS       T01093                                 

Definition
acetyl-CoA carboxylase, putative (EC:6.3.4.14 2.3.1.12 6.4.1.3)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
tgo  Toxoplasma gondii
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    TGME49_021320
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TGME49_021320
   00640 Propanoate metabolism
    TGME49_021320
  Lipid metabolism
   00061 Fatty acid biosynthesis
    TGME49_021320
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    TGME49_021320
Enzymes [BR:tgo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     TGME49_021320
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     TGME49_021320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 2599 aa AA seqDB search
MPIRTHARVRSVCTMGVVSRAAAASWPLASRARDSGALWGGLGNDGEAGNRFPVTFSLSG
ETNGKPQTHHCSRPIDHRETRRGNGGVSGFFVFLFLFFFSPLSATAGPTQSGNLLPYTGG
PWESSRRPEDGHRAFSLASSQPIFFGLPAASSGPSHVGNPHGSDLVPPSSLSPSSSVVSS
FAVSSPVSAHGLRKRRPMLPFSRSRRSMTFLSGPPISASPSSVSSSARFPSRSCSSLSLH
REARDSPRCHGVSCSVFESPELRHATFLSHPVPHSPLSSPATPASFSSRSAPGNQSAIQA
STTESRVGEREGEATPTRVGDGEGDPLADYVRKHGGKRVIRRVLIANNGMAATKSIFSMR
QWAYMELGDDKLLEFVVMATPEDMRANPEFIRRADKIVEVPGGPNRNNYANVDLICQIAV
QEKVDAVWPGWGHASENPNLPRRLSELGITFIGPSATVMAALGDKIAANILAQTAGVPSI
PWSGDSLKATLDSTGAIPRDIFDQATVKSVEECEKVADRIGYPMMIKASEGGGGKGIRMV
DRKEQVRGAYEQVVAEVPGSPVFMMQLCTAARHIEVQIVGDEDGQAVALSGRDCSTQRRF
QKIFEEAPPTTVVPPHTMKEMEKAAQRLTQSLGYVGAGTVEYLYNRKDDKFFFLELNPRL
QVEHPVSEGVTGVNLPAAQLQVAMGIPLWRIPDIRRFFGRDPNAGDRIDFINEDYLPIQR
HVLASRVTAENPDEGFKPTSGRVDRLEFQPLENVWGYFSVGASGGVHEYADSQFGHIFAT
GKNREEARKKLVLGLKRVDVRGEIRTPIEYLVQLLEDKDFIENRIDTSWLDKLIKQRKRL
GEKKVEKAHVVLAAVLFRAIRALKEKEQRVLSALQRGQRYIHDLASLNTVSQEVVYEDQR
FSFEVSRTGPQLYVLKLNTQEVECVVREQPDGSYIVLFPGEKSHKFNGREEPLGLRLQVD
GTTVLLPNVFDPSELRSDVTGKVVRYLVPDKGQVKKGEPYVEVEAMKMIMTLTAGETGVL
SHTKSPGSVVNTGDVLGTLALEDPSRVKKIVDFSGLLDLPRVKKREAADAREKQTEGTGA
TFSLFGSPEDEAAMRLRLAMEGYEQDVESTVQKLAFPSVDSRNLQTKKEKLTELLVELFQ
SFLSVDEHFASVQGGEVAVDGPAAEKKVQDPATLLKLKLAHSRLQPRIQLVLSLLRALQN
FPNFFPEWTMPVSLELCLTRLAALHGRAYGQIALEAIRLLRSFRVAPFEQRVQRLKAELL
QLPSTSKAGSASERETNVRRAERIARSGTASAGIDLLSHLFGDGSVSLKALEVAVRRHYR
GFPIDALHTELFEVETQDGSKKEIPVAFWSFRQGDLTGAEAPLRTGVMGAFQSLEEVQEV
GDRLLARLRQFDEEKRKDEGLGESHREREDTQEPRNVCLFALTTPMDFGTEEEKLKSRMQ
GIIHSLQPSLQSADVRLAAVHVPQVNKSCRMFNFLASDGFDESRIRRDLCPTVPSLIELN
RLQTSFDLTRLDALDPNTQAYLALPRLEPSAKGEVSPSSPSTGPGAASAQGASSTSKKPV
SQAQAPQNVFVRRLIFENEVKSDFSDLPRILLDLLDVLDRCASDPRVSATASGRLFLHIV
SPLNLASAKAVTEHFHKMMKRFRSEHNERLLRLRVDQIEVKMHLRKGGSGSDGEKRSSRE
EGAEATGSQAKEKERLQVLRLSVSSHQGSWLHTKASEDVPHVLTGDPIAQRSFVFDEGEE
TDAEGFVAQASPAGSGAEGADGAKSRATEKTGQREGDAAPVVSREPPEAEGLLGRISVGL
KTLRGTQTSATGSAGAGEMPAASSSLPGRWEGGDRKKQELLSVSRREENEFFRHEKDADP
YPEVDRIAMARSAARRAGSTYIFDFLGLMEIALLQSWQTHLKEKGEKDGGVGGWDEAVPR
DLFKAEAFKVSAQGTLYLDPDWRVADNKIGMVGFLITLKTPEYPSGRQVVLLGNDITFQG
GSFGVPEHLFFTQVSRLSREQGLPRVYIACNSGARIGLYENLKDKIKVEWNDASNPSLGF
KNLYLSAEDYAALPPGVVSGHFEEAVNGDQRRFVLDAIIGDPDKFIGVENLRGSGTIAGE
TSRAYDETFTLSYVTGRSVGIGAYIVRLAQRTIQMVRGPLLLTGYQALNKLLGREVYASQ
DQLGGPEVMFRNGVSHLVVQNDQEGMKEVLRWLAYTPKTARDSVSSAEMFSSDPVEREVA
FTPTKAPYDVRHMLAGYTKEDGTFVSGFFDKNSFKEYLAGWGKSVVVGRARLGGIPFGAI
AVETRTTEARVPADPSSPDSRESVVMHAGQVWFPDSAYKTAQAINDFNRGENLPLIIFAN
WRGFSGGTRDMFEEILKFGSQIVDALRTYKQPVFIYIPPHGELRGGSWVVVDPTINLQKM
EMYADANARGGVLEPPGICEIKYRAADQKALMHRVDDTASDAIDLKEKIKRREAALEPLY
LSIARFYADLHDRPERMKARGVISSIVNWKNSRTFFYWRAKRRLLQDDLEARILAADARL
DFTKARAKIDDLLKSHGVDIASDKAACEFLSNTEGKEATQAIVERSRREGAIEKIRDILS
SLPESERRETLESAATPAR
NT seq 7800 nt NT seq  +upstreamnt  +downstreamnt
atgccgatacgcacacacgctcgagtccgctccgtctgcaccatgggagtggtgagccgc
gccgcggccgcgtcttggcctctcgcttctcgcgcgcgtgacagcggagctttgtggggc
ggcttggggaacgatggcgaagctgggaaccggtttccggttactttctctttatctggg
gaaacgaacggaaaaccacagacacatcactgctctcggccgatagatcacagggaaacg
cggcggggaaatggcggggtctcgggtttcttcgttttccttttcttgttcttcttcagt
cctctctccgccactgccggacccacgcagtccggcaatctcctcccctacacaggcgga
ccgtgggagagttcgagaagaccagaagacggtcatcgtgcattctctctcgcgtcctcg
cagccgattttcttcggcctacccgccgcttcttctggcccttcccatgtgggcaatcct
cacggatcagacctcgttccgccttcctccttaagtccctcctcttccgttgtctcgtct
tttgctgtctcgtctcccgtctctgctcatggcctgaggaaaaggcggcccatgttgcct
ttctcgcgctcgcggcgctctatgacctttctgtctgggccgcccatctcagcttctccc
tcgtctgtttcttcgtctgcccgcttcccttctcgttcttgctcgtctttgtcgctgcat
cgtgaggctcgtgacagtccccggtgtcacggggtttcttgttccgttttcgagtcaccc
gagctcagacacgcaacgtttctgagtcatcctgttccccactctcctctctcgtctcca
gcgactcccgcttctttctcttcccgttcagctccaggcaaccagtcggcgattcaggcg
tcaaccacggaatcgagagtgggagagagagagggcgaagctacgccgacgcgtgttggc
gacggggaaggagaccctcttgccgattatgtccggaaacatggaggcaagcgagtcatt
cgccgcgtcctcatcgccaacaacggcatggcagccaccaagtcgatcttctccatgcgt
cagtgggcctacatggaactcggcgacgacaagcttttggagttcgttgtgatggcaacc
ccagaagacatgcgagcgaatcctgagttcattcgccgcgcagacaagatcgtggaagtt
ccagggggtccgaatcgcaacaactacgcgaacgtcgatttaatttgtcaaatcgctgtc
caggaaaaggtggacgcagtgtggccgggatgggggcatgcatcggagaatccgaatttg
cctcgtcgtttgtcggagttggggatcacgttcattggccctagtgcaacagtgatggct
gctcttggagataaaatcgcggccaacatcctcgcgcagacagcaggcgttccgagcatt
ccctggagtggagattctctcaaggcgacactcgacagcacgggcgccattcctcgcgat
attttcgaccaagcgacagttaagagcgtggaggaatgcgagaaggtggcagaccgcatt
ggttatccgatgatgattaaggcgagtgagggagggggtggaaaaggaattcgcatggtc
gatcggaaggagcaggttcgcggggcgtacgagcaagtcgtggctgaagtcccaggatct
cctgtcttcatgatgcaactctgcactgccgctcggcatatcgaagttcagattgtgggg
gacgaagatggacaggctgtcgctctcagtggccgcgactgcagcacgcaacgacgcttc
cagaagatatttgaagaagcaccgccgacgactgtcgttcctccccacacaatgaaagag
atggagaaagcagctcagcgcctgacgcagtctcttgggtacgtgggcgccggcaccgtc
gagtacttgtacaatcgaaaagacgacaagtttttcttcctcgagttgaatccgagactg
caggtggagcatcctgtctcggagggcgtcaccggtgtcaatttgccggctgctcagctc
caagtggccatgggaattcctctgtggcgaattccagatattcgccggttctttgggcga
gacccaaacgcaggcgaccgcatcgacttcatcaatgaggactacctccccatccagcga
catgtcctcgcgtctcgagtgacggcggagaatcccgacgaaggattcaagccgacgagt
ggtcgcgtagatcgcctggaattccagcctctggagaacgtctggggatacttttccgtg
ggcgccagtggaggggtccacgagtacgcagattctcagtttgggcacattttcgcgacg
gggaagaatcgcgaggaggcgcggaagaagctggtgctcggcctgaagcgcgtggatgtc
cgtggcgagattcggacgccaatcgagtacttggtgcagctgctggaagataaagacttc
atcgaaaaccgcatcgacacctcctggctcgacaaactcatcaaacagcggaaacgcttg
ggcgaaaaaaaagtcgaaaaggctcacgtcgttctcgcggccgttctctttcgagccatc
cgcgcgctcaaggagaaagaacagcgcgtgctgtctgcgttgcagcgagggcagcggtac
atccacgacctggcctcgctgaacacagtttcccaggaagtcgtgtatgaggatcagcgt
ttctctttcgaggtttcgcgaacgggtccacagctgtacgtattgaagctgaatacgcag
gaggtcgagtgtgtggtgcgcgagcagccggatgggtcgtacattgttctttttccggga
gagaagtcgcacaaattcaacggacgcgaagagcctctcggcctgcgcctgcaagtcgac
ggtacgacggtgttgctgccgaacgtattcgacccctctgagctccgttcagacgtgacg
ggaaaagtcgtccgttacttggttcccgacaagggccaggtgaagaagggagagccgtac
gttgaggtagaagcgatgaagatgataatgactctgaccgccggcgagacgggggtgctg
tctcacacgaagagtccggggagcgtggtcaatacgggcgatgtgttggggactctcgct
ctcgaagatccaagtcgcgtgaagaagatcgtcgacttctcaggtcttctggaccttcca
cgagtgaagaaacgcgaggcagcagacgcgagggagaagcagacagagggcactggggcg
accttctcgctcttcggaagcccggaagacgaggccgcgatgcgtctgcggctcgcgatg
gaggggtacgagcaagacgtcgagtcgacggtccaaaagctcgcgttcccctccgtcgac
tcgcgaaacttgcagacgaagaaagaaaaactgacggagctgctggtcgaactcttccag
tctttcctgagcgtcgacgagcacttcgcctccgtccagggcggcgaggtcgccgtcgac
ggccctgctgctgagaagaaagtccaagatcctgcgacgctcctcaaactgaaactcgcg
cacagccgcctacagccgagaattcaacttgtcctctcgctcctcagagctctgcagaac
ttcccgaatttttttccggagtggacgatgccagtttccctcgagttgtgcctcacgcgt
ctcgcggccctgcacggccgggcgtatggccagattgcgttggaggccataaggcttctg
cgttcgttccgagtggcgccgtttgagcagcgcgttcaacgcctgaaggcggagcttctc
cagcttccttcgacctcgaaggcaggctctgcctcagagcgggagacgaacgtgcgacgg
gcggagagaatcgcgaggtccggcaccgcgtctgcgggcatcgatctgctctcccacttg
ttcggcgacggaagcgtgagcctcaaggctttggaagttgcggtccgccggcactaccgc
ggcttcccgatcgacgcgttgcacacggagttgtttgaggtggagacgcaagatggatcg
aagaaggaaatcccggtggccttctggagtttcagacaaggcgacttgacgggtgccgaa
gccccattgcgcactggcgtcatgggggccttccagagccttgaggaggtgcaggaagtt
ggagacaggttgctcgcgaggctcagacagttcgacgaggagaagcgtaaggacgagggc
ctgggcgagtcccacagagagcgcgaggacacacaggagccgaggaatgtgtgtctcttt
gcgctgacgacgccgatggatttcggcactgaggaagagaaactgaaatcgcgcatgcag
ggaatcatccacagtcttcaaccttctttgcaaagcgccgatgtccgcctggccgcagtc
cacgttcctcaggtcaacaagtcgtgccgcatgttcaactttctcgcgtccgacggattc
gatgagagccgcatcaggagagatctttgtccgacagtcccgtctctgatcgagttgaac
cgtctgcaaacgtcgtttgacttgacgcgcctagacgccctggatccgaacacgcaggcg
taccttgcccttccgcgcctggagccctcagcgaagggcgaggtgtctccatcgtctcct
tcgacggggccgggcgcggcgtctgcccagggggcttcgtcgacttcgaagaagccggtg
agtcaggcgcaggcgccgcagaacgtgtttgtgcgccgtttgatttttgagaacgaggtg
aagagcgacttctccgatctgcctcgaatccttctggaccttctggatgtgctggaccgt
tgtgcaagtgatccacgagtgtctgcgaccgcctctgggcgcctgttccttcacatcgtc
tcgccgttgaatctggcgtctgcaaaggcggtgacagagcattttcacaagatgatgaag
cggtttcgcagtgagcacaacgaacggcttctccggctccgcgtcgaccaaatcgaagtc
aaaatgcacctgaggaaaggcgggtccgggtcggacggagagaagcgatcaagtcgagaa
gaaggcgccgaggcgactggctctcaggcgaaggaaaaggaacgcctccaggtgctgcgc
ttgtcggtcagctcccaccagggcagttggctccacaccaaagcttcggaagatgtgcca
catgtgttgacgggagatccgatcgcgcagagaagcttcgttttcgacgaaggcgaggag
accgacgcagagggcttcgtcgcccaggcctcgccggcgggcagcggagcggagggagct
gacggggccaagtcgcgggcgacagagaagacgggacaacgagaaggcgacgctgcgcca
gttgtcagcagagaaccgccagaagccgaaggccttctaggacgcatctcagtaggtttg
aagactctgcgaggtacgcagacaagcgccacaggaagcgcaggcgcgggagagatgcct
gcggcctcgtcttctcttcctggtcgctgggaaggaggtgacaggaagaaacaggagctc
ttgtccgtctcgcgcagggaggaaaacgagttcttccgacatgaaaaagacgccgacccg
taccccgaggtcgaccgcatcgccatggcgagatcggctgccaggcgagcaggctccacg
tacattttcgactttctcggactcatggaaattgccctcctacaaagttggcaaactcac
ttgaaggagaaaggcgagaaagacggaggcgtcggcggatgggacgaggctgtgccccgc
gatctgttcaaggctgaggccttcaaggtgtctgcacagggcaccctgtacctggatccg
gactggcgcgtcgcagacaacaagatcgggatggttggctttttgattacgctcaagacg
ccggagtatccgtctggtcgtcaggtggtgttgctgggaaacgacatcacttttcagggc
ggctctttcggggttccagagcaccttttcttcacgcaagtttctcggttgtctcgcgaa
cagggcttgccacgcgtgtacattgcatgcaacagcggcgcgcgcatcggtttgtatgag
aatttgaaggacaagatcaaagtggagtggaacgacgcgtcgaatccgagcctgggtttc
aagaacctctacctgtcggccgaggactacgcggcgttgccgccgggggtcgtcagcggg
cactttgaggaagcggtgaatggagaccaaaggcggttcgttctcgacgcgatcatcgga
gatcccgacaagttcataggggtcgagaaccttcgggggtcggggacgattgcgggggag
acaagtcgagcctacgacgaaaccttcactctgagctacgtgaccggccgatctgtgggt
atcggcgcctacatcgttcgtctcgcccagcgcacgattcagatggtgcgcgggccgctt
ctgttgacggggtatcaggccttgaacaagttgttaggtcgggaggtatatgcctctcag
gatcaactcggagggcctgaagtcatgttccgaaacggtgtttctcacctcgtggtccag
aacgaccaggaggggatgaaggaagtcctgcgctggctcgcgtacactcctaagacagcg
agagacagcgtgagctctgcggagatgttttcctccgaccccgttgaacgcgaagtcgcc
ttcactcccacgaaggcgccctacgacgtccgccacatgctcgccggatacacgaaagaa
gacggcacctttgtttccggattcttcgacaagaactcattcaaagaatatcttgccggg
tggggcaaaagcgttgtggtgggcagagcgcgactcggaggaattcccttcggcgcgatt
gccgtcgaaacgcgaacgaccgaggcaagggtacccgccgaccccagcagcccagactca
cgagaaagtgtcgttatgcatgctggtcaagtctggtttcccgactcggcgtacaagacg
gcgcaggcgatcaacgacttcaaccgcggcgagaatttgcctctgattatttttgcgaat
tggcgtggattctctggaggcacgcgagacatgtttgaggagattttgaaattcggttct
caaatcgtcgacgctttgcgcacgtacaagcagcctgtcttcatctacattccaccccat
ggcgaactgcgaggtggctcctgggtcgtcgtcgaccccaccatcaatttgcagaaaatg
gaaatgtacgccgacgccaatgctcgcggcggagttctcgaacctccaggaatctgcgaa
atcaagtaccgagctgccgaccaaaaagctctcatgcatcgtgtagacgacaccgccagc
gacgcaatcgacttgaaggagaaaatcaaacgcagagaagccgccctggagccgctttac
ctttcgatcgcacgattctacgcggacttgcacgatcgaccagaacgcatgaaggcacga
ggtgtcatttcctcgattgtcaactggaagaattcacgcacctttttctactggagagca
aagcggcgacttctccaagacgatttagaagcgcgcatcctagcagccgacgcgcgactc
gacttcactaaggcgcgtgcgaagatcgacgatcttctgaaaagccatggagtcgacatc
gcgagcgacaaggctgcttgcgaattcctcagcaatactgaagggaaagaggcgacgcag
gctatcgtagaaaggagccgacgagaaggagcgattgaaaaaatccgagacattctttcc
tctttgccggagagtgaacgcagggaaacgctcgaaagcgctgctacgccagcccgttga

DBGET integrated database retrieval system