KEGG   Toxoplasma gondii: TGME49_022860Help
Entry
TGME49_022860     CDS       T01093                                 

Definition
eukaryotic translation initiation factor 3 subunit 9, putative
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
tgo  Toxoplasma gondii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TGME49_022860
Translation factors [BR:tgo03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    TGME49_022860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 756 aa AA seqDB search
MVRIDKDDLPAEEQDLLEFLSEDSDEGEDDDSEQGEEKLKEKLSQMEPLLQMDYSFPSTI
VLVGVPKVGKDKHEKLRLVLDKKMGEELLKKGAESVNEGLTISMPVNEETGMTKGFCFVT
FSNQFNAQHAAHHLNGWALDAKHTFRAALLDDFDEIVGRGANYRPPIKLLGFTRENFRWW
LLDARGREQFVIRYAGETEIYWHDPIERDCSVLVYNGHRERADGKRVWTDFRVQWSPQGS
FLATFHRPGIALWAGDQFEKKVRFEHKDVKQIDFSPNETYVITWDGSPAQLRNEKAVRIW
KVMTGELLRQFPTPAYSPRGGEYPHFLFSHDDRYVARMGEKELCVYQMECDDEPEAEGEK
SDEKGRKDRCAVRLLRDPRDGKLSSLKYPLEKFEWSPTENIISVWIKGSEDAPGRLLLVE
IPSRRELSSKNVYNVKGASMHWQSKGDFLCLRTVAFKKTGKKGKKEFTQLEIFRMREKDI
PVDNVQLNDVAVQLHWEEGYSKRFALVVHDEQTSNQALRFYRVCDASEDGKRDTILIYSF
DISGYMNYMQWSPFGSYFILASLGLDGTLLFCCLNDQDTVQVLHMDEHFMVNEVRWSACG
RYLSTAVVLPMLPSSNTASFRLGSNTGYKIWTFQGKLQYKCQKDQFYQFLWRPHPPSLLK
KEKIEEIKKKMKDYSKRYEAEDEKLRLEQRSAFIRQRKEEMDEFTKVLDGLNQWKVDHEL
YDDWQLAYETFDAQFDWEDKEEVIEDELEVKEEIIT
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggttcggatcgataaggacgacctcccagcggaggaacaagacctcctggagtttctg
tctgaagacagcgacgaaggcgaagatgatgattctgaacaaggagaggagaagctgaag
gagaagctttctcagatggagcctcttcttcagatggactactcctttccgtccactatc
gttcttgttggtgttcccaaggtcggcaaagacaagcacgagaaactgcgtcttgtctta
gacaagaagatgggagaggagttgttgaagaagggcgctgagagtgtaaacgagggcctc
accatttcgatgcctgtcaacgaagaaaccggaatgacaaagggcttctgctttgtcacg
ttcagcaaccagtttaacgcacagcatgcagcgcaccacctcaatggctgggcgctggat
gcgaaacacactttccgggctgctttgttggacgacttcgacgagatcgttggacgcggc
gcgaattaccgcccgcccatcaaactcctcggattcacccgcgagaacttccgctggtgg
ctattggatgcccgtggccgcgagcaattcgtcattcgctacgctggcgagacggagatt
tactggcatgacccaattgagagagactgcagcgttctggtctataacgggcatcgagag
cgcgctgacggcaagcgtgtgtggacagacttccgcgtccagtggtctcctcaaggttct
ttccttgcgacgttccacaggcctggtatcgcgctctgggcgggtgaccagtttgagaag
aaagttcgttttgagcacaaagacgtcaaacagatcgacttttcgcccaatgagacgtac
gtgatcacttgggatggaagccctgcccagctgcgcaacgagaaggcggttcgcatctgg
aaggtcatgactggcgagcttctgcggcagttccccacacctgcttactctcctcgtgga
ggcgaatatccgcattttcttttctctcatgacgaccgctacgttgcgcgcatgggcgag
aaggagctctgtgtctaccagatggagtgcgacgacgagccagaagctgaaggcgaaaag
agcgatgaaaaagggagaaaggatcgctgcgccgttcgtcttctgcgtgacccgcgcgac
ggaaagctgtcgtctctgaagtatcctcttgaaaagttcgagtggtcgccgacagaaaac
atcatttctgtctggatcaagggatctgaagatgctcccggtcggctgcttttggttgaa
attccgagtcgtcgcgaactgagcagcaagaacgtgtacaacgtcaagggtgcgtcgatg
cactggcagtccaagggagacttcctctgccttcgtacggtcgcgttcaagaaaaccgga
aagaaggggaagaaagagtttactcagctcgaaatcttccgtatgagagagaaggacatc
ccggtcgacaacgtgcaactcaacgatgtggctgtgcagctgcactgggaagaaggatac
agcaagagattcgctcttgttgtccacgatgagcagacgagcaaccaggctcttcgattc
taccgcgtgtgcgatgccagcgaagacggcaagcgcgacacgattttgatttactccttc
gacatcagtggatacatgaactacatgcagtggtcgccgtttggttcgtacttcatcctt
gcttctctcggtctcgacggaactctccttttttgctgcctgaacgatcaagacactgtc
caggtgctccacatggatgaacacttcatggtcaacgaagtcaggtggtctgcatgcggt
cgatacctcagcacggcggtcgtgctcccgatgcttccgagcagcaacaccgcctccttc
cgtctgggttccaacacaggttacaagatctggacgttccaaggcaaactgcagtacaag
tgccaaaaggatcagttctaccagttcctgtggcgaccacatccgccgtcgcttttgaag
aaagagaagatcgaggaaatcaagaagaaaatgaaggattacagcaaacggtacgaggca
gaggacgagaaactgcgactggagcagcgatccgccttcatccgtcaaagaaaggaggaa
atggacgaatttaccaaagtcctcgacggactcaaccagtggaaggtcgaccatgagctt
tacgacgactggcagctggcttatgaaacattcgacgcccagtttgactgggaggataaa
gaagaagttatcgaagacgaactcgaagtcaaggaggagatcattacataa

DBGET integrated database retrieval system