KEGG   Toxoplasma gondii: TGME49_023410Help
Entry
TGME49_023410     CDS       T01093                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4E, putative
  KO
K03259  
translation initiation factor 4E
Organism
tgo  Toxoplasma gondii
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TGME49_023410
Messenger RNA biogenesis [BR:tgo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     TGME49_023410
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     TGME49_023410
Translation factors [BR:tgo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    TGME49_023410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 198 aa AA seqDB search
MAAKFLSFNQELNEAVDLKDWVKEEPVPDEPLPLRYVWHVWEQVQQDDRSKEYSDNTRDL
AAFDTVQKFWQLWSFIPQPSELLDHKRMVRQDKNGRSHVVDAVMIFKEGIKPMWEDPRNA
TGGHFEYRLSFPQMSAGQIDEYWNNLVLGLIGSTVEGSDHITGVRLVRTVSQNCSCGEMK
VAVVQFLQVFSVFWCPFR
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaaattcctctctttcaatcaggaactgaatgaggctgttgacctcaaggac
tgggtgaaggaggagccggttccagacgaaccgcttcctctgcggtatgtctggcatgtt
tgggagcaagtgcagcaggacgaccgatccaaagagtactcagacaacacccgggatttg
gcagccttcgatactgtacagaaattttggcagctgtggtcattcattccccagccgagc
gagcttctggaccataaacggatggtcaggcaggacaagaacggtcggagccatgtcgtc
gatgctgttatgattttcaaggaaggaatcaagccaatgtgggaggatccccggaatgcg
actgggggtcattttgagtatcgcctttctttcccgcagatgagtgcaggacagattgac
gagtactggaacaatttggtccttggccttatcggcagcactgtcgaaggcagcgatcat
atcactggtgtccgtctggtaagaactgtgtcccaaaattgttcatgtggcgagatgaag
gttgctgtcgttcagtttcttcaggttttttctgttttttggtgtcctttcaggtag

DBGET integrated database retrieval system