KEGG   Toxoplasma gondii: TGME49_023410Help
Entry
TGME49_023410     CDS       T01093                                 

Definition
eukaryotic translation initiation factor 4E, putative
Orthology
K03259  
translation initiation factor 4E
Organism
tgo  Toxoplasma gondii
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TGME49_023410
Messenger RNA biogenesis [BR:tgo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     TGME49_023410
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     TGME49_023410
Translation factors [BR:tgo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    TGME49_023410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 198 aa AA seqDB search
MAAKFLSFNQELNEAVDLKDWVKEEPVPDEPLPLRYVWHVWEQVQQDDRSKEYSDNTRDL
AAFDTVQKFWQLWSFIPQPSELLDHKRMVRQDKNGRSHVVDAVMIFKEGIKPMWEDPRNA
TGGHFEYRLSFPQMSAGQIDEYWNNLVLGLIGSTVEGSDHITGVRLVRTVSQNCSCGEMK
VAVVQFLQVFSVFWCPFR
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaaattcctctctttcaatcaggaactgaatgaggctgttgacctcaaggac
tgggtgaaggaggagccggttccagacgaaccgcttcctctgcggtatgtctggcatgtt
tgggagcaagtgcagcaggacgaccgatccaaagagtactcagacaacacccgggatttg
gcagccttcgatactgtacagaaattttggcagctgtggtcattcattccccagccgagc
gagcttctggaccataaacggatggtcaggcaggacaagaacggtcggagccatgtcgtc
gatgctgttatgattttcaaggaaggaatcaagccaatgtgggaggatccccggaatgcg
actgggggtcattttgagtatcgcctttctttcccgcagatgagtgcaggacagattgac
gagtactggaacaatttggtccttggccttatcggcagcactgtcgaaggcagcgatcat
atcactggtgtccgtctggtaagaactgtgtcccaaaattgttcatgtggcgagatgaag
gttgctgtcgttcagtttcttcaggttttttctgttttttggtgtcctttcaggtag

DBGET integrated database retrieval system