KEGG   Toxoplasma gondii: TGME49_024480Help
Entry
TGME49_024480     CDS       T01093                                 

Definition
protein kinase, putative (EC:2.7.12.1)
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
tgo  Toxoplasma gondii
Brite
Enzymes [BR:tgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     TGME49_024480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1678 aa AA seqDB search
MSWDAHSSFCQTVPLRSRSGWESAASPSALTHTASRGLAAGLRLPSLPEQLSPLPASPLP
SSPLPSSVLPSSPLPSSPLPSSVLPSSPLSSSPLPVSPLRGSPPLQESPSLSAASSVSAA
RSEVSVEPPFEPQVAALSPHSPSPHAVFSPLLPFSSSLVSSLASPVDAPPLLEAREEERE
PSRWTSSREERVDEDGGELERRDASGDRGKRRCVFSDQTRSCEGRLAATLGPSRRDRKGE
CLHAPCDLPATARFEPAVFCGKRDCVAAHPGCGEAPFLSGEETDHLGLRRGRASPRACRG
DSRAELDAVPRFPWASVSSFSPALGVGDSGKSSRGAKRRDRDTRDSAGPHPDEAGLDLRS
QTLEEKGDVPQRRERDRQRDSAAVYGTGRAFEEGLPTLASGKEEKTENGRGRRRRRARAR
RRAGRVQVSGRQGGPEASQQPTDFSASLAPGDEKTRVGEKRKTRLKSREAYERSRVLGGL
DSSEPTSRGQGNGRVFPPFYALYAPLSSPLPSYVSSSSSSGFYSSSRGVSWTPQAPVDGL
ESPLNANLSRYFSCSSSSRLPSSFFSGTLPSAFLDVSSIPSPGSYFSSFVSSPLCPSAAP
LLAFQAPPPHGSHAGCAVPYSSSLYPPFLKANSASPALLTSPLCAVPAAAALPAVSSGCR
DTGLGSTACLHPGDYLRLWRYHLWCLRRNAERRRASSGSRSIRYPRSRRRSSSSQSSLHS
KTGRGRAPGCDEEDRKRRSPREARQRKSTGSPAPPRRSASPRDRSRSSRAESRQRRERKR
ASRRRESSEAQSAGDREARAAEGYSCVSTPRPGEFPIPGSAASRLESGQTPLEASTQAPR
VPPAEIWTEGGEGKMGDSSSSPSRRSHRRRKHEWGGEGRRERTGGSRRSRTRYRGREEGR
SSRRSASEAADGRCRSGEDRARKREPGVHTPGATSSVYCGGAAESRFESPHSTRRGLPSA
QRDGHPAREGSANGAASLVYRHHKRRDGREESEGNRSRTFNRSKRRSSELQKAPGGRDSR
RSLNKSRRPSDARDRSRGRDEKTQNSRNTRGDAGSSRGTQDARRRERRKARRSRSEAGEF
LLASRQTSRERAKRRKEERRRSDDSPFSRKRRREERPGRRSDLHASEARERKSDFSGGRR
EGGRRDERRGGGRSKRSLTSSRSRRQRQRRSESAYEGRRDPREPRERERRRREESSCRRY
EPRRRRYEEDSRYPSCSARGGFLPFFYPSQRSSLFPSVVLKRQRPGESFKEKSYRYSETA
WREGRREREKKRETRDERGTRRRTRTRRRDVERRRAKKKEKKEDNGKDDIIHFDWRPGMW
LTDRYRVLDKMGEGTFGRVLRCADVHTQRDVAIKVVRDVSRYTSAAKIEVDILREINERD
AGTVSSVSPAYSSHCVRLHDAFLYKGRHMCLVFEKLGKSLYDLLTDNHYQGFYLEDIRTV
AKQCLIALAFLRVCRLTHTDLKPENILLLDDILIPVSAPRPSSSSSKGRYLRPAQVGVKI
IDFGSATFEDDYHSSLINTRQYRAPEVILGLGWDMSSDVWSLGCILMELYTGNLLFRTHE
HLEHLAMMEKIIGPMPANMLEAAVSTDGRRYLSPASLGSSGGEEREESSRLRLNWPEGSS
STNSEERVRNCVPLQALVLPHHRIFSDFVASLLQIDPQARPTPGDALMHPFFSADLLE
NT seq 5037 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgggatgctcactcctcgttctgccagacagttcccttgcgctcgcggtcaggt
tgggagagtgccgcttcgccttctgcgctgacacacactgcgtcgcggggcctcgccgca
ggacttcgcctgccttcgcttccagagcaactctcgcctttacctgcctcgcctttgcct
tcctcacctctgccttcctcagtgttgccttcttcacctctgccttcctcacctctgcct
tcctcagtgttgccttcctcacctttgtcctcttcaccgttgccagtttctccgttgcgc
ggttctcctcctctccaggagtcgccgtctctctctgcggcttcgagtgtctctgccgcg
cgctctgaggtgtctgtggagcctccgtttgagccgcaggtggcggctctgtctccgcac
tcgccgtctccacacgcggtcttcagtcctcttttgcctttttcctcttcgcttgtctcc
tcgctcgcgtcgcccgtggacgcgccgccgctgctcgaggcgcgggaagaagagcgagag
ccgagtcggtggacgtccagccgagaagagcgcgtggacgaggacggcggcgagctcgag
cgacgcgacgcgagtggagacaggggcaagaggcgctgcgtcttttccgaccaaactcgg
agctgcgaaggccgcctcgccgccacgctcggaccctcccgcagagacagaaaaggcgag
tgtctccacgcgccctgcgacctgcccgcgactgcgcggttcgaaccagctgtcttctgc
ggcaagcgggactgcgtcgcggctcatccaggctgtggagaagcgccttttctgtcggga
gaagaaactgaccacctcggtcttcgccgcggccgcgcgagtccccgcgcatgcagagga
gactcgagggcggagctcgacgcggtgccgcgtttcccgtgggcgtctgtctcttcgttt
tcgcctgctctgggagttggggactcggggaaatctagcagaggagcgaagcggagagac
cgagacactcgcgactccgcgggtccgcatccagacgaagcaggcctcgacttgcgctcg
cagactctcgaggagaagggagacgtgcctcagaggcgcgagcgagaccggcagagagac
tcggccgcggtctacgggactggacgcgctttcgaagaaggcctgccgaccctcgcgtcg
ggcaaagaagaaaagacagaaaacgggagagggagaagaagacggcgcgcgcgcgcccgc
agacgcgcagggcgtgttcaggtgtctggacgccaggggggacccgaggcgtcccagcag
ccgacagacttctccgcgagcctcgcgccaggtgacgagaagacgcgcgttggagagaag
cggaaaacgcgactgaaatcccgtgaagcatacgaacggtcgcgagttcttggaggtctc
gacagttcggaacctacatcgcgaggtcaagggaacggtcgcgtctttcctccgttttat
gcgttgtacgcgcctctttcgtctcccttgccttcgtacgtgtcttcttcctcttcatcg
ggtttctactcttcgtcgcgcggtgtctcttggactccacaggctccagtggacggcttg
gagtctcccctgaatgcaaatttgtctcggtacttttcctgttcgtcttcttcccgcttg
ccgtcttccttcttcagcgggacccttccgtctgcatttctcgacgtctcctcgatcccg
tctcccggttcgtacttttcttccttcgtctcttctccgctctgccccagcgccgcccct
cttctcgccttccaggctcctccaccgcacggcagccacgccggctgcgccgttccgtat
tcttcgtctctctatcctccttttctgaaggcgaactcggcgagtccggcgcttctgact
tcgcctctctgtgccgttcccgccgcggccgccctccccgctgtctcttcggggtgccga
gacaccggcctcggttccacagcctgtctccaccctggggactacttgcggctctggagg
tatcatctctggtgtctccgccggaacgcagagcgaagacgcgcaagcagcgggtctcgc
agcatccgctatccgcgcagccggcgacgctcctcatcatctcaaagttctctccactcg
aagacaggcaggggtcgagcgccaggctgcgacgaagaagaccgcaaaaggcgcagtccg
agggaggcgagacagcgaaagtcgacaggctcccctgctccgccgagacgcagcgcttca
ccacgagatcgaagtcgctcttcgcgggcggagagccgtcaaaggagagagagaaaacgt
gcctctcgtcgacgtgaatcttccgaggcgcagagcgcaggcgacagagaggcgcgcgcc
gctgaggggtattcgtgtgtatcgacaccgcgtccaggcgagtttccgattcccggttct
gcggcttcgcgactggagagcgggcagacgccgctcgaggcaagcacgcaggcgcctcgc
gttcccccggcagagatctggactgaaggaggcgagggaaagatgggagactcctcgtct
tcgccttcgcggcgatctcacagacggaggaaacacgagtggggtggcgaaggccgcaga
gaacggacagggggaagtcggagaagtcgaacgcggtacagaggtcgagaagaaggcagg
tcgagtcggaggtccgcgtcggaggctgcggacggaaggtgccggagtggagaggaccgt
gcgagaaagagggaaccgggtgtacatacacccggggcgacctcttcggtgtactgcggc
ggcgccgctgaatcgcgcttcgagtctccgcactcgactcgcagagggctgccgagcgcc
cagcgagatggacaccccgcgcgcgaaggcagcgcaaatggcgcagcgtctctggtgtac
agacaccacaaacggcgcgacggccgcgaagagagcgaggggaatcggagccgaacgttc
aatcggagcaagcgtcggtcgagcgagttgcagaaagcccccggtggcagagacagcaga
cgctctctgaacaagtcgcgaagacccagcgacgctcgagacagaagccgaggcagagat
gaaaagactcagaactcgcgcaacacacgcggagacgcagggtcttcgcgggggacgcag
gacgcgcggcggcgcgagcgacggaaggcgaggcggtctcgttcagaggctggggagttt
cttctcgcgtccaggcagacgtcgcgggagagagcgaagcgcagaaaggaggagcggcga
cgcagcgacgactcgcctttctcgaggaagaggcgccgcgaggaaaggcctggccggcgc
tcggatcttcacgcgagcgaagcgcgagagaggaagagcgacttctccggaggtcggcgc
gagggcggtcgtcgcgacgagagacgcgggggggggcgcagcaagaggtcgctcacgtcc
tcgcggtcgcggcgtcagagacagcgaaggtcagagtctgcgtacgaggggaggcgcgat
ccgagagagccgagagagcgagagcggcgacgccgcgaggagtccagttgcaggcggtac
gagccccgcaggcgcaggtacgaagaggactcgcgctatccttcgtgctcggcgcgaggc
ggcttccttccgttcttctaccccagccagaggtcttcgctgttcccgtccgtggtgctg
aagcggcagcggcccggcgaaagcttcaaggagaagagctaccgttacagcgagacggcg
tggagagaagggaggagagagcgcgagaagaaacgcgaaacacgcgatgagcgaggcacc
cgaaggcggactcgcacgcgccgcagagacgtagagaggagacgcgcaaagaagaaggaa
aagaaggaagacaatggaaaagacgacatcatccacttcgactggagaccgggaatgtgg
ctgaccgaccggtaccgagttctcgacaagatgggcgaaggcacattcggacgcgtcctc
cggtgcgcagacgtccacacgcagagagatgtcgcaatcaaggtggtgagagatgtctct
cggtacacatcggcggcgaagatcgaggttgacattctgcgagagatcaacgaacgagac
gcgggcaccgtgtcatccgtctcccccgcgtactcttcacactgcgtgcggcttcacgac
gccttcctgtacaaaggaaggcatatgtgtctcgtctttgaaaaactcggaaagagtctc
tacgaccttctcacggacaaccactaccagggcttctacttagaggacatccggactgtc
gccaagcagtgtctcatcgctctagccttcctcagagtctgcaggctcactcacacggac
ctcaagcctgaaaacatcctccttctggacgacattctcattccagtttcggcgcctcgc
ccgtcgagcagctcgtcgaagggtcgctatttgcgtccggctcaagttggagtgaaaatc
attgatttcggcagtgcgacgttcgaggacgactaccattcttcgctcatcaacactcga
caatatcgggcgccagaggtgattctcggactggggtgggacatgtcgagcgacgtctgg
tcgctgggctgcattttgatggaactttacacgggaaatctcctgttccggacgcacgag
catctggaacatcttgcgatgatggaaaaaatcattggaccgatgccggcgaacatgtta
gaggcagctgtatcgacagatgggcgcagatatctctcacccgcttctctcggctcttcg
gggggagaagagagagaagaatcctcgcggctgcggctgaactggcctgaaggctcttcg
agcacaaacagtgaagaacgcgtgcgaaattgtgttcctcttcaggccctcgtcctgccg
caccaccgaattttttcagactttgtggcctctttactgcaaatcgacccgcaagcgcga
ccgacacctggcgacgcattgatgcatccttttttcagtgcggatctgctcgagtag

DBGET integrated database retrieval system