KEGG   Toxoplasma gondii: TGME49_026910Help
Entry
TGME49_026910     CDS       T01093                                 

Definition
glycogen debranching enzyme, putative (EC:3.2.1.33)
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
tgo  Toxoplasma gondii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TGME49_026910
Enzymes [BR:tgo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     TGME49_026910
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     TGME49_026910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1882 aa AA seqDB search
MSVKALNPRRLPPPGQAATEFFGETVEKFISYFDSAGELEAPNKNAGNFRVSKGVTVDLV
VLNGSQRRPVVACVVETPLGEEDKLPKRTADFGHLVFTFKAALAGPYRIQLEYGPVVASQ
SGAAANNEDRVIGEKDAEASASRSPASVIIVEPSLSINGVALKQESISLQTVLSRCLGPF
SGWKRMFTQTAELGYNVIHFTPLQALGESGSCYSIADQLHISDFFLEDKSLTGERGLEGD
SSGAGQAAPGAVMALRRAASSDIVGLEELQAIIRMMETDLGLLSTIDLVLNHTASNSPWL
QDHPDSGYSPANSPWLRGAYELDWKLQEFSRRIVRGEFAEKYGATKEINDEGQLQNVMRA
FDEELLKPFRMSEWFLLHVDDTVKTWKDACAENAEENPLKLADGELQDRLFNEALKQVGV
KRGATIVISGSVTRRLFAPSEEGRLRQVLNNVNGRLAEKAEESARFVRQAIEGNARWERL
QCKRGALGEKHWEALAPRYFTPLNEDEHEVTDRTVLANNGWVMGWKATEDFAAAGALVYL
RRELVVWSDCVKLRYGDKPEDSPFLWRHMTEYCRIAAKVFHGVRLDNCHSTPIHVAQHML
RECRRIRPDFWIFAELFTGSQAVDLHFERCLGINALVREAMQTHDAGDLVNHLKRFGMQS
GLGQLSPVAAIDRREAPMRAAPNASGNLSSQASKRPADAACVRGESKREDAAFDADSTVE
LNQVDERGKAKSSPSSSGTDCRGTDCRGTECRGVPLRPVLCPALFYDCTHDNETPAQKFT
PGASLPLSVLLAGAGCAVGSTRGYDESVPSTLSVVSEDRLYEDYHREVPLVNPLNLVAEK
RRAAHTGSDTERPENREAAAAHAREKRVPNEIKISWPHGGKRVIVRGSWDGWQADVAGTR
DDASGRVEITLKKGVHYAIGQPPEEDRPEKLHFKFVVDGHWTVNNELPCENDGGNVNNVL
CTDSRAPGGWTPGDGLPGILTIRPILNAMHVKAGQEEFNQLSAECKTDDLVVVVRHHPVT
HECIYFIARCAYGWQRGDPPLPEIVLSGRIKEVPLAATLFIPGDAREKFKPAPSRINGLP
FSAQVFPDLAHFAPNAKFDASTNSTTLRLQNFPRGSALIICTAPASAFLDASAVAHARVK
HPGFSRAAAAHSALRAHASRLSPLLREVSLTAMSELLYSCNQEERDRGHGPYTVGGYGEL
VYAGLCGPAALLDQIRILDFDKQTQHPLLENLRQGYWLLRYSVDRLTHPSLAPVKQWLKE
AVDIVECEFPVYAWLRPFYADAILAHAYATCCSFVLDKMPLTRKSQLPAGVPEVAPLCMK
KAKGDMRRGEARGAHAVNGKNACARDQVAVQRVEPSAETFGERCGVVADKLLAELQVATL
QFYSFVPSAPLISGTTRPSLSAGLPFFSSGFMRAWGRDTFIALRGILLTTGRYEAAKAEI
LGFARVMRHGLIPNLLDSGNNPRYNARDATWFFCQAIQDYSLCAPDGLQILKEPVEMKYE
GNATQAPDLPIKNLADVLHHILLSHAKGIEFREWNAGRQIDEQMRDEGFNVRVFMDPCSG
LIFGGNQFNCGTWMDKMGSSEKAGNRGLPATPRDGAAIEIVGLLKSTLRFVTRLPESVFP
YKTVTTSSGQEMTYVRWNSLLEARVETCFYVPKDPQQDAEYFLDGKLINRRGIYKDTYKA
SEAWRDYQLRPNACVALAVAPELFDRTHAREYLDAVEKALWGPKQLGLKTLDPSDWNYRP
DYDNANDSTDFHVAHGYNYHQGPEWVWPLGYFLRAKLIFAEEFDEEPGAGGKSAGPTKRA
SLKVQEDCMRFLQNHRHHLQTDVWKSLPELTNSNGSFCKDSCQAQAWSVATLLAFLGDLV
SDPVDLRKVGLKASPNAVEDDA
NT seq 5649 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtcaaggcgttgaatccgaggcgtctgcctccgcctgggcaggctgcgacggag
ttcttcggggagactgtcgagaagttcatctcttatttcgactccgcaggagaactcgaa
gcccccaacaagaacgctggaaatttccgtgtctccaaaggcgtgacggtcgatttggtg
gtgttgaacggctcgcagcgtcgcccggtcgttgcatgcgttgtggagacgccgttggga
gaggaggacaagctgccgaagcgcactgcagactttggtcatctcgtcttcacattcaag
gccgctctcgccggtccttaccgcattcagctggagtacggccccgtggtcgcttctcag
tcgggagcagcggcgaacaacgaggacagagtaattggagaaaaggacgccgaagcttct
gcctcgaggtcgcctgcctcggtcatcatcgtcgagccttcgcttagcatcaacggcgtc
gctctcaaacaagaaagcatttccctgcagactgtcctctccaggtgtctgggaccgttc
agcggatggaagcgcatgtttacgcagactgcagagttgggctacaacgtcattcacttc
acacctctgcaggctctcggcgagtccggttcttgctacagcattgcggaccagttgcac
atcagcgacttctttctcgaggacaagtcgctgacgggagagaggggactggaaggagac
agttctggcgcgggtcaagcggcgccaggcgctgtgatggcgctgaggagagctgcgagc
agcgacattgttggcttggaagagctgcaggcaattattcgcatgatggagaccgacctc
ggactccttagcaccatcgacctcgtcctcaatcacacagccagcaacagtccgtggctc
caggaccatcccgacagtggatacagcccagcgaactcgccgtggctccgcggggcgtac
gaactcgactggaagctccaggagttcagccggaggatcgtgcgaggcgagttcgctgag
aagtacggagcgacgaaggagatcaacgacgaaggccagctgcaaaatgtgatgcgcgcc
ttcgacgaagagctcctgaaaccgttccgcatgtctgagtggtttctcctccacgtcgac
gacacagtgaagacgtggaaggacgcctgcgcagaaaacgccgaagaaaacccgctgaag
ctcgccgacggcgaactccaagaccgcctgttcaacgaggcgctgaagcaagtcggtgtg
aagcgcggcgcgaccattgtgatctcaggatccgtgactcgccggctgttcgcgccgtct
gaagagggccgtctgagacaggtgctgaacaacgtaaacggtcgacttgcagagaaagca
gaagagtctgcgcgatttgtgagacaagcgatcgagggcaacgcgcgctgggagcgcctt
cagtgcaagcgcggcgcgcttggcgagaagcactgggaagcgctcgcgccgcgatacttc
acaccgttgaacgaagacgaacacgaagtgaccgaccgcacagtgctcgcaaacaacggc
tgggtgatgggctggaaagccactgaggactttgctgctgccggcgcactggtctatctg
cggagagagctggtcgtctggtctgactgcgtaaaactcaggtacggtgataaacctgaa
gattcgccttttctctggcgtcacatgaccgagtattgccggatcgcggcgaaagtcttt
cacggcgttcgccttgacaactgtcactccacgcccatccacgttgctcagcacatgctt
cgcgagtgtcgtcgcattcgtccagatttctggattttcgcggagctttttactgggagt
caagcagtggatctgcactttgagcgttgcctaggaatcaatgcactggtgcgcgaggca
atgcagacgcacgacgcaggcgacctggtgaaccatttgaaaagattcggcatgcagagc
ggcctcggccagctgtcgcctgtcgccgcgatcgatcggcgagaagcgccgatgcgcgca
gcaccgaacgcgtccggcaacctctccagccaagcctcgaaacgccctgcagacgctgcg
tgtgtacgcggcgaatcgaagcgcgaagacgccgccttcgacgccgactccaccgtcgag
ttgaatcaagtcgacgagcgagggaaggcgaagtcctctccttcttcgtcgggaactgac
tgtcgcggaactgactgtcgggggaccgagtgtcgaggagttcctctccgtcctgtgctc
tgtccggcgctcttctacgactgcacacacgacaacgaaacgcccgcgcagaagttcaca
ccgggagcgtcgctgccgctctcggttctcctcgcaggtgcaggctgcgctgtggggtcg
acgcgaggctacgacgagtcagttccgagcaccctttctgtcgtctcggaagaccgcctg
tacgaagactaccaccgcgaggtgcctctcgtgaatccactgaatctggtcgcggagaag
cgtcgggctgcacacactggctccgacacagagcgccccgagaaccgggaggctgctgct
gcgcatgcacgcgagaaacgcgtccccaacgagatcaagatctcctggcctcacggcgga
aagcgtgtgattgtgcgaggaagctgggatgggtggcaggccgacgtcgcggggacgcga
gacgacgccagcggacgcgttgaaattactctgaaaaagggagttcactacgcgatcggc
cagcctcccgaggaagaccggccggagaaactccacttcaaattcgtcgtcgatggacac
tggactgtgaacaacgagttgccttgtgaaaacgacgggggaaatgtgaacaacgttctc
tgtacagacagccgggctcccggcggatggacacccggcgatggcttgccgggcattttg
acgattcgcccaatcttgaatgcgatgcatgtgaaggccggacaggaagagttcaaccag
ctgtctgcggagtgcaagacagacgacctcgtcgtcgtcgttcgacatcaccctgtgacg
catgagtgcatttacttcattgcgcgatgtgcgtacggctggcagcgcggcgacccgcct
ctccctgagatcgtcttgagcgggaggatcaaggaggtccctctggcggcaactttgttt
atccctggagatgcgcgagaaaagttcaaaccggctcccagtcgcatcaacgggctgccg
ttctccgcgcaagtttttccggacttggcccacttcgcgcccaacgcgaagttcgacgcg
tcgacgaattcgacgacccttcgtctgcagaacttccctcgcggctcggcgttgatcatc
tgcacagctccggcttctgcgtttctggatgcctccgcggtcgcgcatgcgcgcgtcaaa
caccctggcttctcgcgcgcagccgccgcgcattcggcgctgcgcgcccatgcctctcgg
ctttctccgctgctgcgcgaggtgtctcttaccgcaatgtctgagcttctctactcatgc
aatcaagaggaacgagaccggggacatggaccgtacaccgtggggggttacggcgagctc
gtgtacgccgggctctgcggccccgctgcgcttctcgaccaaattcgaattctcgacttc
gacaaacagacccagcatccgctcctcgagaacctccgccaaggctattggctgctgagg
tactccgtcgaccggctgacgcacccatcgctcgcgcccgtcaagcagtggctcaaggag
gcagtggacatcgttgagtgcgagttccccgtctacgcatggctgagacctttctacgcc
gacgccattcttgcccatgcgtacgcaacctgctgcagcttcgtcctcgacaagatgccg
cttacgcgaaagtcgcagctgcccgcaggcgttccagaagtcgcgcctctctgtatgaag
aaggcgaagggtgacatgcgtcgtggggaggcgcgcggcgcgcatgcagtgaacggaaag
aacgcctgcgctcgagaccaagtcgcagtccagcgagtcgaacccagcgcggagaccttc
ggcgaacgttgcggagtcgtcgcagacaagttgctggcggaactgcaagtcgcaacgctc
cagttctactcctttgtcccctctgctcctctgatctctggcacgacgcggcccagcctc
agcgcggggctccccttcttctcctctgggttcatgcgcgcctggggcagagacaccttc
attgctcttcgcggcattctcttgaccacagggcgatatgaagcagcgaaagcagaaatt
ctcggcttcgcgcgggtgatgagacatggcctcatcccgaatctcctcgactcgggcaac
aaccctcggtataacgcccgtgatgctacatggttcttctgtcaggcgattcaagactat
tccctctgcgccccagatggcttgcagatcttgaaggagccagtggaaatgaagtacgaa
ggcaacgcgacgcaagcccccgatttgccgatcaaaaatctcgccgatgtcctccaccac
atcctcctctcgcatgcaaagggaatcgagttccgcgaatggaatgcaggccgccaaatc
gacgaacagatgcgcgacgaaggattcaacgtccgcgtattcatggatccctgcagcggc
cttatattcggaggcaaccaattcaactgcggcacttggatggataaaatggggtccagt
gaaaaggctggaaatcgtgggttgccagcgacccctcgcgacggcgcagccatcgaaatt
gttggactgctaaagtccaccctgcggttcgtcactcgcctgccggagtcagtctttccc
tacaagactgtcaccacctcgtcagggcaggagatgacgtacgtccggtggaactcgctg
ctggaggcgcgcgtcgaaacctgtttctacgtccccaaagaccctcagcaagacgcagag
tactttctggatgggaagctcatcaatcgtcgaggaatttacaaagacacgtacaaggcc
tcggaggcctggagggactatcaactccggccgaatgcatgcgtcgctctcgcagtggcg
cctgagctctttgaccgcacgcatgcacgcgaatatctggacgctgtcgagaaggcgctg
tggggaccaaagcaactgggactgaagaccctcgacccgtcagactggaattacagaccg
gactacgacaatgccaacgactcgacagacttccatgtggcgcatggatacaattaccat
cagggtccggagtgggtctggccgttaggatactttcttcgagcgaagctgattttcgcc
gaggagttcgatgaggagccaggcgccggcgggaagtccgcagggccgaccaagcgcgca
agtctcaaggtgcaagaagactgcatgcgtttcctgcagaaccaccgacaccatctgcag
acagacgtctggaagtcgcttccagagttgacgaactccaacgggtccttctgcaaggac
agttgccaggcacaggcttggtccgtcgccacgcttctcgcctttctcggcgacctggtc
tccgaccctgtcgatctccgcaaagtcggcctgaaggcctccccgaacgctgtggaagac
gacgcgtga

DBGET integrated database retrieval system