KEGG   Toxoplasma gondii: TGME49_028290Help
Entry
TGME49_028290     CDS       T01093                                 

Definition
phospholipase/carboxylesterase, putative (EC:3.1.1.1)
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
tgo  Toxoplasma gondii
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:tgo00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 285 aa AA seqDB search
MASLQPGDGYGGEGFHRFPGVCTPQTASLVFMHGLGDTAAGWADLVSLLSSLSCFPALRV
ILPTAPVRPVTLNGGFPAPAWTDIFSLSKDAPEDKPGFLASKQRIDAILAGELAAGVAPE
RIILAGFSQGGALAYFTGLQASVRLGGIVALSTWTPLAQELRVSAGCLGKRDTQSRKEAL
QTREEEKTEEEKEEEKKEEKKEEKEKRVEGPTPVLHCHGEQDELVLIEFGQESAAIVRRQ
YAEAWGEDVAKKAVKFLSFQGLGHSANAQELDQVRRFIENVLTTN
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctctccagccaggcgacggctacggcggcgaaggcttccaccgcttcccgggt
gtctgtacaccgcagacggcgtctctcgtcttcatgcacggtctgggcgatacggccgcg
gggtgggccgacctcgtttcgctgctttcttcgctctcatgttttcctgcgcttcgggtg
atcctcccgacggcgcctgtgcgccctgtcacactgaacggcggctttccggcgcccgcg
tggacagacatcttctcgctgtcgaaagacgctcccgaagacaagccaggcttcctcgcc
tccaagcagcgcatcgacgccattctcgccggcgagctcgcagccggcgtcgctcccgag
cgaattatcctcgcaggattcagtcaaggcggcgccctcgcctacttcaccggcttgcaa
gcctcggtccgcctaggcggcatcgtcgcactctccacctggacgcctctcgcgcaggaa
ctcagagtcagcgcaggctgcctcgggaagcgagacacgcagagccgcaaagaggcgctg
cagacgagagaggaagagaagaccgaggaggagaaggaagaagagaagaaagaggagaag
aaagaagaaaaggagaagagagtggaggggccgacacctgtgttgcattgccatggagag
caggacgagttagttttgattgaatttggtcaagagagcgcagcgatcgtgagacgacaa
tacgcagaggcttggggggaagacgtcgcgaagaaagctgtcaaattcctgtccttccag
ggtctcggccactctgcgaacgcgcaggaactcgatcaggttcgacgattcatcgaaaac
gtcctcacaacaaactga

DBGET integrated database retrieval system