KEGG   Toxoplasma gondii: TGME49_028290Help
Entry
TGME49_028290     CDS       T01093                                 

Definition
phospholipase/carboxylesterase, putative (EC:3.1.1.1)
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
tgo  Toxoplasma gondii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TGME49_028290
Enzymes [BR:tgo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     TGME49_028290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 285 aa AA seqDB search
MASLQPGDGYGGEGFHRFPGVCTPQTASLVFMHGLGDTAAGWADLVSLLSSLSCFPALRV
ILPTAPVRPVTLNGGFPAPAWTDIFSLSKDAPEDKPGFLASKQRIDAILAGELAAGVAPE
RIILAGFSQGGALAYFTGLQASVRLGGIVALSTWTPLAQELRVSAGCLGKRDTQSRKEAL
QTREEEKTEEEKEEEKKEEKKEEKEKRVEGPTPVLHCHGEQDELVLIEFGQESAAIVRRQ
YAEAWGEDVAKKAVKFLSFQGLGHSANAQELDQVRRFIENVLTTN
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctctccagccaggcgacggctacggcggcgaaggcttccaccgcttcccgggt
gtctgtacaccgcagacggcgtctctcgtcttcatgcacggtctgggcgatacggccgcg
gggtgggccgacctcgtttcgctgctttcttcgctctcatgttttcctgcgcttcgggtg
atcctcccgacggcgcctgtgcgccctgtcacactgaacggcggctttccggcgcccgcg
tggacagacatcttctcgctgtcgaaagacgctcccgaagacaagccaggcttcctcgcc
tccaagcagcgcatcgacgccattctcgccggcgagctcgcagccggcgtcgctcccgag
cgaattatcctcgcaggattcagtcaaggcggcgccctcgcctacttcaccggcttgcaa
gcctcggtccgcctaggcggcatcgtcgcactctccacctggacgcctctcgcgcaggaa
ctcagagtcagcgcaggctgcctcgggaagcgagacacgcagagccgcaaagaggcgctg
cagacgagagaggaagagaagaccgaggaggagaaggaagaagagaagaaagaggagaag
aaagaagaaaaggagaagagagtggaggggccgacacctgtgttgcattgccatggagag
caggacgagttagttttgattgaatttggtcaagagagcgcagcgatcgtgagacgacaa
tacgcagaggcttggggggaagacgtcgcgaagaaagctgtcaaattcctgtccttccag
ggtctcggccactctgcgaacgcgcaggaactcgatcaggttcgacgattcatcgaaaac
gtcctcacaacaaactga

DBGET integrated database retrieval system