KEGG   Toxoplasma gondii: TGME49_033500Help
Entry
TGME49_033500     CDS       T01093                                 

Definition
triosephosphate isomerase, putative (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tgo  Toxoplasma gondii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:tgo01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tgo01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tgo00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tgo00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tgo00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 375 aa AA seqDB search
MSGSASSVHFCAPPQSPFLLTLFISALCLAPSFFARPSNAFHLAAGSAASLGSANFQRSE
QLALKPLSPAAEPSGLAAPAAFVRMTKCTYTAPSPGRHAHLRRAGALDSSASALWAARRG
FVGGNWKCNGTTAKTQELVDMLNSAPVSFEQVDVVVAPPSLFISQVQDSLRQPRVQVAAQ
DSSTQQAYGAFTGELSPKMIKEKNIPWVVLGHSERRAGFGGQPGESNQVVAKKVRAALNE
GLSVILCIGETLEERESGQTQKVLSEQLEAVRQAVPEADAWKSIVIAYEPVWAIGTGKTA
TAALAQETHRDIRNWLAQAVSPKVAEATRVIYGGSVKGSNAKELFEGEDVDGFLVGGASL
TGDFVSIIDAAKQQA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggctccgcttcctctgtgcatttctgcgctcctcctcagagcccctttctcctc
accctcttcatctccgccctttgtctggctcccagcttcttcgcacgacccagcaatgcc
tttcacctcgcggccgggtctgccgcctctctcggctctgcaaacttccaacgttctgag
cagctcgcgctaaagcctctttctccggccgcggagccctcggggctggctgcccccgcc
gccttcgtccgcatgaccaagtgtacgtacaccgcaccgagtccgggacgccacgcgcac
ctccgccgggcaggcgcgctggacagctccgcctcggctctctgggctgcacgtcgaggt
ttcgtcggcggcaactggaaatgcaacggcacgacggcgaagacacaggagctggtcgac
atgctgaactccgcgccagtctcctttgagcaagttgacgtagtggtagcgcctcccagt
ctcttcatctcgcaggtgcaagacagcctgcgacagccgcgcgtccaggtggctgctcaa
gattcttcaacccaacaggcctacggcgccttcactggcgagctttccccgaaaatgatc
aaagagaaaaatattccctgggtggtgctggggcacagcgagcgtcgcgcgggcttcgga
gggcagccgggcgagtccaaccaagtcgtggcgaagaaagtgcgcgcggcgctcaacgaa
ggtctcagcgtaattctctgcatcggcgagacactggaagagcgcgaaagtggacagaca
cagaaagtcttgagtgaacagcttgaggctgtgcgtcaggctgtgccggaggcggatgcc
tggaaatcgatcgtcatcgcctacgagcctgtctgggcaattgggacaggaaagacggcg
acggcggccttggctcaagagacgcaccgggacattcgcaactggctagctcaggcggtg
tccccgaaggtggcggaggcgacgcgtgtgatctacggaggttctgtcaaaggcagcaac
gcaaaggagttattcgagggcgaagacgtcgacgggtttcttgtcggaggtgcctcgctg
acaggcgactttgtctccatcattgatgcagcgaagcagcaagcctaa

DBGET integrated database retrieval system