KEGG   Toxoplasma gondii: TGME49_033900Help
Entry
TGME49_033900     CDS       T01093                                 

Definition
serine/threonine-protein kinase, putative (EC:2.7.11.17)
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
tgo  Toxoplasma gondii
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    TGME49_033900
Enzymes [BR:tgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     TGME49_033900
Protein kinases [BR:tgo01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   TGME49_033900
Mitochondrial biogenesis [BR:tgo03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    TGME49_033900
  Mitophagy factors
   Other mitophagy factors
    TGME49_033900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 412 aa AA seqDB search
MCTPAWPGVSPLCASSPSMPSASSSAPPCLAAAVAAAAAANQNAAAAAVAAAATGGITGT
TIGPYRLGSTLGVGTFGKVKLGYHNVTGQKVAVKIINKAKMEMMEMYEKIRREINILQCL
HHPHVIRLYELIDTPTDIFMVMEYVQGGELFDHIVQKSRLPEHEARRFFQQIVSGVDYCH
RHMICHRDLKPENVLLDTNMNVKVGDFGLSNFMRDGDFLKTSCGSPNYASPEVVSGKAYA
GPEVDVWSCGVILYALLCGSLPFDDEHVPNLFKKIKHGNFILPGHLSEASRNLIVRMLVV
DPAKRISLSEIRQHPWFTESLPAYLQSCYLGSPLLTRVDPLIVLQMKKLGYDVDEKNLNT
FTAVGTFPTRETVAYQLLADRRAKQSSFSSSSLRLSVTLHAHVSSRNISSFQ
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgtgcacgccggcatggcctggggtgtctccgctctgcgcgtcttcgccttcgatgcct
tctgcgtcttcttcggcgccgccctgcctcgcggccgccgtcgcagctgccgcggcggcg
aatcaaaacgcggcggccgctgcggtcgcggctgcggcaacgggcggcatcacggggacg
accatcggaccctatcgtctcggttccaccctcggagtgggaacctttggcaaagtcaaa
ttgggttaccacaatgtgacgggtcagaaggtggcggtgaagattatcaacaaggcgaag
atggagatgatggagatgtacgagaaaattcggagagaaatcaacatcttgcagtgcctt
catcatccacatgtgattcgcctctacgagctcatcgatactcccacagacatcttcatg
gtcatggagtatgtccagggtggcgaactcttcgaccatatcgttcaaaagtcgcgtctc
cccgaacatgaagcgaggagatttttccagcaaattgtctccggtgtcgattactgccac
cggcatatgatttgtcaccgtgacttgaaaccggagaacgtgttgctggacacaaacatg
aacgtgaaggtgggggacttcggcttgtcaaatttcatgcgagatggagactttttgaaa
acctcttgtgggtctccgaactacgcgtcgcctgaagttgtctcggggaaggcgtacgca
ggtcccgaagtcgatgtctggtcttgcggagtaattctctacgccctcctgtgcgggtcg
ctccccttcgacgacgagcatgtgccgaacctgttcaaaaaaatcaaacatggaaacttc
atcttgcctgggcacctctccgaggcgagtcggaacttgattgtgcgcatgctcgtggtg
gatcctgcgaagcgaatttccctcagcgagattcgacagcatccgtggttcacagagagc
ctccccgcctacttgcagagctgctacttaggcagtcctctcctcacacgcgtcgaccct
ctcatcgtcttgcagatgaagaagctcggatacgatgtggatgaaaaaaatctaaacacc
ttcacagcggttggaacttttccgactcgagagacagtcgcctaccaacttcttgcagat
cgcagagcaaagcagtcttccttctcaagttcgtctcttcgcctttcagtgaccctgcat
gctcatgtgtcgtcgcgaaatatatcctctttccagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system