KEGG   Toxoplasma gondii: TGME49_038950Help
Entry
TGME49_038950     CDS       T01093                                 

Definition
fatty acyl-CoA desaturase, putative (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tgo  Toxoplasma gondii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:tgo01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:tgo01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 999 aa AA seqDB search
MALLTEIAALWVRDLLRRTLGGRPEQTAWLHLGYWEDPRRSSQVAAFCSRYLWAGAVVYL
ATLVSLSLLFKSAKRMKNAHGQQAHADGKRDSKRCSAPGSTPSLVYMIWNAVVSFVAFLA
LSALVKEDASTFLSPLFRLPSNYRPVTRAVVSLVAPGTFAFFFADTLLCLALERSRLTFT
HVAGHLYFPLFLNYCVETGLSAVHTLVLLHLAGLALGRALAVSSAAAFFVAAPFARREGE
PRSAAKGVLAEQRNRASESTHKHQRGESKRACEERASSEKGEVSSAAEKERETDESGLWA
FFTWCERVLEVMQSWVTAAVCCCALYDPTTGLLAGASSMWTACKWGVSMETLLSYYSISM
YLSHYHKELRAFMFTFLVYFHMFAFVGVLMLLSHRSAWHLFFEVIGFYMVGGLGITCGAH
RLWAHRSYKAALPWRISMLILNSFANQGSIYHWSRDHRVHHKNSDTASDPYDSSKGFFYC
HMGWLLYKKPQEVLIAGKDIDCSDLLEDPCVVIQRKLDPWWNQFFCFVLPGIYGYYVYNS
FWLGFFVHGALRWCMTLHATWTVNSVAHFWGDRPYAPKTRPSESIFTSFVAVGEGWHNWH
HMYPYDYAAAEGGVFENYNPSKLVIDAGALLGLVWNRRRATTAWQRARERRDEMKRQDEE
KLLQRAGSDRQIIYMESIKQMFPARVYRIHTFANLALLARDLLLLVGLSFAAYRLLGIEA
LLDRLDVPAPPSASPLLRASLFTLLVALAVAYAVGSGTLWFALFVHATEAANGKFSGASL
LNHAVASVLQAAMLIPYKPRRAGAPYEVPAISSQVLIFYVGPYLVCNAWMAYYYGLLEGG
GPHDVTNEENNMNFDFAAPSALQWMRSVSEERRRGRKVHRGGLLWSWIDRLHHELPKKHL
MQALTYDVSRQGLGEASRILHQRLAVAPEFSRDSETELDPDATRASVLEEELLLGQDQKG
NENVSMKTGEAIKRKTPVLAPSEELRRREAAAAARACGC
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atggcacttctcacagaaatcgccgccctatgggtgcgcgatttgctccgaaggacccta
ggagggaggcccgagcagacagcttggctgcacctggggtactgggaagaccccaggcgc
agctcccaagtcgcagcattctgctctcgctatctctgggcaggcgctgttgtctacctt
gcaactttggtctctctttcccttctcttcaagtctgcgaaacggatgaagaatgctcac
ggacaacaggctcacgccgacggcaaacgcgacagcaaaaggtgctcggcgccgggttcc
accccctctctggtctacatgatctggaacgccgtcgttagcttcgtcgctttcctggca
ctctccgctctggttaaagaggacgcgtcgacgttcctgtcgccactctttcgcctgccg
tccaattacaggcctgtgactcgggccgtggtgtctttggtggccccgggaactttcgcg
ttctttttcgcagacacgcttctgtgtctggctttggagcgttcacgtctcacgttcacc
cacgttgcaggtcatctgtattttccgcttttcctcaactactgtgtcgagacgggtctg
tcggcagtccacacactcgtgctcctccatctcgcaggcctcgctcttggacgcgccttg
gctgtgtcctcagctgcggccttcttcgtggctgcgccatttgcgcgtcgtgaaggagag
cctcgctctgctgcaaagggcgtcctcgccgagcaaagaaaccgcgcctcagagtcgacc
cacaaacaccagagaggcgagagcaaacgcgcctgtgaagagcgtgcaagctcggagaag
ggagaagtcagcagcgctgcagaaaaagaacgagagacagatgagagcggcttgtgggcc
tttttcacatggtgcgaacgcgtcctggaggtcatgcagtcgtgggtcactgctgccgtt
tgctgctgtgccttgtacgatccgacgacgggtcttctcgctggagcttcttcgatgtgg
actgcatgcaaatggggcgtcagcatggagactcttctctcctactactccatcagcatg
tacttgagtcactaccacaaggaactccgggccttcatgttcaccttcctggtgtacttc
cacatgtttgccttcgtcggcgttctcatgcttctgagtcatcgatcagcgtggcatctc
ttcttcgaagttatcggattctacatggtcggtggcctgggcatcacttgcggcgctcat
cgcttgtgggcgcaccgatcgtacaaggcagccttgccgtggcgaatctccatgttgatt
ctcaactccttcgccaaccaaggctccatctaccactggtctcgcgaccaccgtgtccac
cacaagaattcagacacagcaagcgatccgtacgactcgtcaaagggattcttctactgc
catatgggttggctgctgtacaagaagccccaagaagttctaattgcggggaaagacatt
gactgcagcgacttgttggaagacccgtgtgtcgtgatccagagaaaactcgatccgtgg
tggaaccagttcttctgtttcgttctcccggggatctacggctactacgtctacaacagc
ttctggctcggcttctttgtccacggagctcttcgctggtgcatgacactgcatgcaact
tggacggtgaacagcgtcgcacacttttggggagaccggccgtacgctcccaagacgcgt
cccagtgaatcgatttttacgtccttcgttgccgtcggggaaggctggcacaactggcac
cacatgtacccctatgactacgcagctgccgagggtggcgtcttcgaaaactacaacccg
tccaaactggtcatcgatgcgggagcgcttctggggctcgtgtggaaccggagaagagcg
acgacggcctggcagagggcgagggaaaggcgggatgagatgaagagacaagatgaggag
aagctgctgcagcgagccggttcagacaggcaaatcatttacatggagtcgatcaaacag
atgtttccggctcgcgtgtaccgcatccacactttcgcgaacctcgctctgcttgcgcga
gatcttcttctcctcgtcggcctctcgtttgccgcctaccgccttttgggcatcgaggca
cttctcgaccgcctcgacgttcctgcgccgccttcggcctcgccgctgctgcgggcgagt
ctgttcacgctgctcgtggctctcgctgtcgcctacgcagtcggctccgggacgctgtgg
ttcgctctctttgtacacgcgacggaggcggcgaatggaaagttttctggagcgtctctg
ctcaatcatgccgtcgcgtctgtcctccaagctgccatgctcatcccgtacaaacctcgg
cgcgccggggcgccctacgaagtccccgccatcagtagccaggtcttgatcttctacgtc
ggtccctaccttgtctgcaacgcgtggatggcgtactactacggccttctggaggggggt
gggccgcacgatgtgacaaacgaagaaaacaacatgaacttcgactttgcggcgccctcg
gctctccagtggatgcgcagtgtcagcgaggagcgacgacgaggacgcaaagtccatcgc
ggcggtctcttgtggtcgtggatcgaccgactccaccacgagctccccaagaaacatctc
atgcaggctctcacatacgatgtgtctcgtcaaggattgggagaagcgtcgcgaattctt
catcagcgacttgcagtggctcccgagttttcgagagactctgagacagagctcgatcca
gacgcgacgcgtgcgtcggtgctggaggaagagcttctgttaggtcaggaccagaagggc
aacgagaatgtctctatgaaaactggagaagccatcaaaagaaaaactcctgtcctcgct
cccagcgaggaacttaggcgacgcgaagcagccgccgccgctcgcgcgtgtggatgttaa

DBGET integrated database retrieval system