KEGG   Toxoplasma gondii: TGME49_040890Help
Entry
TGME49_040890     CDS       T01093                                 

Definition
phosphofructokinase, putative (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tgo  Toxoplasma gondii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TGME49_040890
   01230 Biosynthesis of amino acids
    TGME49_040890
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TGME49_040890
   00030 Pentose phosphate pathway
    TGME49_040890
   00051 Fructose and mannose metabolism
    TGME49_040890
   00052 Galactose metabolism
    TGME49_040890
Enzymes [BR:tgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TGME49_040890
Protein phosphatases and associated proteins [BR:tgo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TGME49_040890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1399 aa AA seqDB search
MAYPPSGVDADKTNLRRGRSLLVVTNDNQYTLSSTPPEAEQTETQREASRPLHARGGRPV
RKLSFRRPPSGVAAASCREMLGMTRLASSVGSQNFGFGGAFYGQPHLSRDLSSSSAFPVH
QREQRARTHLHSADLFDRTSPVQKARQAWTCTLPAALDADTHTLVSGPPLDAKVKEAFEA
GPLAQPPEVQKKLEALFPATWGFEYTEVAPGPVEVDGGEGSRQRVVTRIGIVLSGGPAPG
GHNVIAGLHDFVKSRHPDSVVFGFMGGLDGVINKKYKVLTDELMNQYRNQGGFDMLWSGR
GKVNGEEDLRKAKEVCESLELHGLVLVGGDGSNSNAALLAEFMQVHLPSCAVVGVPKTID
GDLKSPLIEASFGFDTAAKTYSELIGNLCTDINSSQTTYHFVRVMGRSASHLVLECAMQT
RPNLVFIGEEVDAANMCLADIVKQTADLVIERLHAGKRYGIILLPEGLIEFIPEMKVLIK
ELNEVLSANDGKFSPDKLTRARSVWDYLPDMIQDQLMMDREATGYIQVAKIATERLLILL
LETELQKRGYDPDQWSFMPHYFGYEGRCAMPSNFDANYCYSLGYTAGVLAEKGKNGYMSI
VRNLDQHPSLWTPAGVPFTKMMYVKQDAQGKDFPAIVRSLVSLDGSLFKVFCEVRDKWKL
KDLYRVPGPIQFAGVTADEPCYAVMVPSAEDLLAGNDPRANLTCTTGVVEKDLGTYSSLQ
QQRLLYRPTVPPLCQDAKARARPSKQMFCRDPYTQRQVLMHYPYLSNSSLFFLHDVCHDK
YIPPIGFGVRIGLVFISRQSPGVANVLWGLHERLKLVQGKCIAFFGLNGLVDRKFLQIED
RHLELFKNQGGCELIGRSTSHCLGSREMQEKVRQTCEAMNLDGLVIPGSAFAMSEAALLS
EYFLAKQCRTSVIGIPATGSNNLSGELIETCIGFDSSTKVYASLIGNVLTDAASMPKYWH
FVRLMGRQPSHEVLECALQTHPNFVIIAEEYGAADKTLLHVVQDIADVVCQRAEMGRNFG
TVLIPDALLMHLPNMKILLAELRSVLKEADAKGEMKKAQQDLNDVTDTDSCPPESWGRRL
TPWSAALFRSFPKFIRRELLQVDMGEIRFERLETEELLAQMVKEELEYRQSVGRYCGKFQ
AVTHFFGYQGRSSMPSQFDANLAFAYGHLASILVESGVTGHCCSIRGLCGPVKDWHLGSI
PFVTLMKLVPTPQDNPTFAARGGQAGDPKLTNSAKDIRQQRSVMTDLPIIPSAEVNLDGK
AYRWMKTAAEQWALEDRFCNPGPIQFTGPAANFFNRELFEEQAEYYDMVCRVERYTNILR
QTCTFGVSDSFLKNAYVSLTGLLMLAFHPDELTAKLPALTTGDDDADGEGAAPPGSAFFG
RSGEGFGVSLSRFSKREDF
NT seq 4200 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatcctccaagtggcgtggacgctgacaaaaccaacctgcgccgcgggcggtcg
ctcctcgtggtgacgaacgacaaccagtacacgctgtcgagcactccacctgaggcagag
cagacggagacgcagcgggaggcctcgcgccccttgcatgcacgaggcgggaggcctgtg
cggaaactttcgtttcgcagaccgccctcgggagttgcagctgcatcctgtcgagagatg
cttggcatgacgcgcctggcgtcgtcggtgggcagtcagaacttcggttttggtggagcc
ttctacggccagcctcacctctccagggacttgtcctccagcagtgccttcccggtgcat
cagagagaacagagagctcgaacgcatctccactccgcagacctcttcgatcgaacgagc
ccagtgcagaaggcgcggcaagcgtggacttgcacgctgcctgcggctctcgacgcagac
acccacaccctggtttccggtccacctctggatgcgaaagtgaaggaggccttcgaagca
ggacccctggcgcagcctccagaagtccagaaaaaactggaggcactctttcccgccacc
tggggcttcgagtacacagaagtcgctccaggacctgtcgaagtcgacggaggcgaggga
agtcggcaacgcgtggtgacgcgcattggaatcgtcttgagcggggggcctgccccggga
ggacacaacgtgatcgctggattacacgactttgtcaaaagccgacacccggactccgtc
gtcttcggattcatgggaggcctcgacggtgtgataaacaaaaagtacaaggtgctgacg
gacgagctgatgaaccagtatcgcaaccagggaggcttcgacatgctttggtccggacgt
ggaaaagtcaacggcgaggaagaccttcgaaaagccaaggaggtgtgcgagagcctggag
ctgcacggtctggtgctggtcggcggcgacgggtcgaacagcaacgcagcgctgcttgca
gagttcatgcaagttcatctgccttcctgcgccgtcgtgggcgtccccaaaacgattgac
ggagacctgaagagtccgctgatcgaggcttctttcggcttcgacaccgccgcgaaaacg
tactcggaactgatcggcaacctctgcactgacatcaacagctcccaaactacttatcac
tttgtgcgagtgatggggcgcagcgcctcgcacctcgtcctcgaatgcgcgatgcagacg
cgtccgaatcttgttttcattggcgaagaagtcgacgcggcgaacatgtgcctcgcggac
attgtgaagcagacggcggacctggtgatcgagcgacttcatgcggggaagcgctacggg
atcattctcctccccgaggggctcatcgaattcattcctgaaatgaaagtcctcatcaag
gaactcaacgaagtcctcagcgcaaacgatgggaaattctctcctgacaaactcacgcga
gccagaagtgtatgggactaccttcccgacatgattcaagaccagctgatgatggaccga
gaagcgacagggtacattcaggtggctaagattgcgactgagcgcctgctgattcttctg
ctagagacggagctgcagaaacgcgggtatgaccctgaccagtggagcttcatgcctcac
tacttcggctacgagggccgctgtgcaatgccttccaacttcgacgccaactactgctac
tcgctcggatacactgcaggcgttctggcggagaaaggaaagaacggatacatgtcgatt
gtgaggaacttggaccagcatccatcgctatggactccggcaggtgtacctttcaccaag
atgatgtacgtcaagcaagacgctcaaggaaaagatttcccggcgattgtgcgttctctc
gtctctctcgacggttcgctcttcaaagtcttctgcgaggtccgagataagtggaagctg
aaggacttgtacagagtaccggggccgattcagttcgcgggcgtcactgcagacgaaccg
tgctacgccgtcatggttccttctgcagaagatctcctcgctggcaacgaccctcgcgcg
aacctgacttgcaccaccggcgtagtggagaaagacctggggacgtactcctctctgcag
cagcagcgtctgctgtatcggccgacagtgcctcctctctgccaagatgcgaaggcgcga
gcgcgtccgtccaagcagatgttttgccgcgatccgtacacgcagcgccaggtgctcatg
cactatccgtacctctccaacagttcgctcttcttcctccacgacgtctgccatgacaag
tacattccacccataggcttcggcgtccgcattgggctcgtcttcatctcccgacagtcg
ccaggcgtcgcgaacgtcctttggggtctgcacgagcgcctgaaattggtgcaagggaaa
tgcatagccttcttcggactcaacggcttggtcgaccggaagtttctccagatcgaagac
agacacttggaactcttcaaaaatcagggaggatgtgaactgattggccggtccacgagc
cactgtctaggcagcagagagatgcaagagaaagtccgccaaacctgcgaagccatgaac
ctcgacggcctcgtcatccccggaagcgcattcgccatgtccgaagctgccctcctctcc
gagtacttcctcgcgaaacagtgcagaacctcagtcatcggcatccctgcgacaggaagc
aacaacttaagtggagagttgatcgaaacatgcataggcttcgacagcagtaccaaagtc
tacgcctctctcatcgggaacgtcctcactgacgcagcatcgatgcccaagtactggcac
ttcgtgcggctcatgggaagacaaccttctcacgaggtcctcgagtgcgcgctgcagaca
cacccgaacttcgtcatcatcgccgaggagtatggcgcagcagacaagacgttgctccat
gtggtgcaagacattgcagacgtcgtctgtcagcgcgcagagatggggaggaacttcggc
accgttctcattccagatgcgcttcttatgcatctgccgaacatgaaaatccttcttgca
gagctccgcagcgtactgaaggaggcagacgcaaagggtgaaatgaagaaggcgcagcaa
gacttgaacgatgtgactgacacagactcctgcccgccggagtcttggggtaggcgcctc
actccgtggagtgccgccctgttccgcagctttccaaaattcattcggcgcgagcttctg
caagtcgacatgggagaaattcgtttcgagcgactggagaccgaggaactgttggcgcag
atggtcaaggaggaattggagtatcgacagagtgtcggccggtactgtggaaagttccag
gccgtcactcacttcttcggataccaagggaggtcttccatgccctctcagttcgatgct
aacctcgctttcgcctacggccacctggcttcgatattggtagagtctggagtaacgggt
cactgctgtagcattcgcggcttgtgcggacctgtgaaggactggcacttggggagcatt
ccgttcgtgactctcatgaagctggtgccgactccgcaagacaatccgacgttcgcagct
cgcggtggacaagctggcgaccccaaattgacgaattcggcgaaggacattcgacagcag
cgatccgtcatgaccgacctccccatcatccccagtgcagaagttaacctcgacgggaag
gcttacaggtggatgaagacagcagccgaacagtgggcactggaggatcgattctgcaac
cccggccctattcagttcacaggtcccgcggcgaatttcttcaatcgggagttgttcgag
gagcaggcggagtattacgacatggtctgtcgggtagagcgatacacaaacattctgcgg
cagacatgcacatttggagtctcggacagctttctgaagaacgcgtatgtttctctcacg
ggtctgctcatgctcgcctttcatcccgacgaattaacggcgaaactgccggcgctgacg
accggcgacgacgacgccgacggagaaggagcagcgccgccaggcagtgcgttcttcggc
agaagcggggaaggcttcggtgttagtttgtcgcgattctcgaaacgcgaagacttctga

DBGET integrated database retrieval system