KEGG   Toxoplasma gondii: TGME49_042730Help
Entry
TGME49_042730     CDS       T01093                                 

Definition
guanylate kinase, putative (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tgo  Toxoplasma gondii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TGME49_042730
Enzymes [BR:tgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TGME49_042730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 346 aa AA seqDB search
MLAAAADANALSAAATKSRAVAAAAEEERTTAAELLPISSSGGVSPSSANAALREAQRSA
GDAAEDAVLEETNDAREVEENGASEAESGCRRATLLKRILRDTAPRILVVAGPSGVGKGT
LVKRIFAKWPQAFGFSISHTSRQPRPGETHGKEYFFCSREEFEKLKKEGHFVESAEFSGN
CYGTSFAAVDNVRRGERICLLEIDMAGVLQIQSTPLAQEANFVFIQPPSIEELKARLRGR
RTENEEHIAKRLAAAQRELALAKETHFDFYLTNDNLEDAWQKLEAQLVQWYGPVFKKAAG
PGEKRSRLSEEETKAEEAKTEEAKAEEAKAEEAKVEETKVEGNAGE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgctggcggctgctgcagacgcgaatgccctctcggcggcggcgacaaagagccgcgcg
gtggcggctgctgctgaggaagagaggacgacggcagcagagctcttgcccatctcttcg
tctggaggcgtttccccgagctctgcgaatgcggccttgagagaggcgcagcgttctgcg
ggagatgctgcagaggacgcggttctcgaggagacgaacgacgcgagggaagtcgaggag
aacggagcgtctgaagcggagagcggctgcagacgagcgacgctgctcaagagaattctc
cgcgacacggcgccgcgtatcctcgtcgtcgccggcccgagcggagtcggaaaaggaact
ctcgtcaaacggattttcgccaagtggccgcaggcgttcggcttcagcatcagccacaca
tctcgccagcctcgccctggtgagacgcacggcaaggaatattttttctgttctcgcgag
gagttcgagaagttgaagaaggaaggtcactttgtggagtctgcagagttctctggaaac
tgctacggcacctctttcgccgccgtcgacaacgttcgacgcggagaacggatctgtctc
ctcgagatcgacatggctggcgtcttgcaaattcagtccactcctctcgctcaggaagcc
aactttgtcttcattcaacctccctcgatcgaagaattgaaggcccgacttcgcggacga
cgcacagaaaacgaagaacatattgcgaagaggctggcagcggcgcagcgcgaattagcg
ttagcgaaagaaacacactttgatttttatctcacgaatgacaacctggaggacgcgtgg
cagaaactcgaggctcagcttgtccagtggtacggacctgtctttaaaaaagcagccgga
cctggagagaagaggagcagactgagtgaagaggaaacgaaggcagaggaggcgaagaca
gaggaggcgaaggcagaggaggcgaaggcagaggaggcgaaggtggaggagacgaaggtc
gaggggaacgcaggagagtag

DBGET integrated database retrieval system