KEGG   Toxoplasma gondii: TGME49_043440Help
Entry
TGME49_043440     CDS       T01093                                 

Definition
histone acetyltransferase GCN5, putative (EC:4.1.1.70)
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tgo  Toxoplasma gondii
Brite
Enzymes [BR:tgo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TGME49_043440
Transcription machinery [BR:tgo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     TGME49_043440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1032 aa AA seqDB search
MAPSECPSDAPGGSGESRVSAEPSSSETPSSAVSSHSPHRAQLSSTQPKNPASPPTSDVS
APHVPLLGAEASGGDPSADPLGGEGAMERERQAFAEGPGLSARVETALSPQLRTTSGELQ
QAAADAAVSPDGEKEKEVANSRKGEDSGRLSAFVGRGSRRSSHAEPAEGPSLPSGADGRL
PASGPWASEAPPAGRSASAPVPPVSPGFAFPSVTSCLPLNASIGDIALRLVKEILQPVLA
RDIQVDPPSPFRFTASGMAKALELSPVCFSPAYAASLRKSYAQMGTAGSCFYCVSAPCVC
GAFAPPLAQARPAENKKRGRDACEGPQAEPPVGRGPRRGPNDSGAPVGQDLPGGPQAPGG
PGGGFGAGQTFQDNLRQMCLFHPYSSVPPPKLIDMRYLCLFLSASADSPFACATRTGLCP
FFGDGPFGPDGETRNGREGPLARSGDKVEGEKTFLSFVDETADFGDASVEKGFPDHARIG
WEVVEEVAESLEAIFNTIQMETVEDRRDALTVPDEFYAQNYWEWRQFLLDKAPTGASVSR
TFGRSLLRSLLLASPGTIAKDLQRTPISFAAGILFFRLCEEVGIEPETRHVLWRTVASSQ
PELRSRLVSESGLGFLCRDLGSAKEEEAGLITFKCVTNDRQPFSSRALVTVKNIFSRQLP
KMPREYIVRLVFDRNHYTFCLNKEDTIIGGCCFRPYFQQKFAEIAFLAVTSTEQVKGYGT
RLMNHLKEHVKKSGIEYFLTYADNFAVGYFRKQGFTQKISMPRERWYGYIKDYEGGTLME
CHINPRINYLRLSEMLHDQQQVIKRATVSLKPLAVYPGLDFWKKNPGQTLSPSQIPGLLQ
CGWHPGEGAPRAGADGKGISEAERAFLGSTGAPDGAGSAGVGQGYMRPLHEQIMDILDAL
GKHHSAWPFLKPVSREEAPDYYDVILQPTDISTMKKKCKKKHYTTAQMFADEVQLMFKNC
RQYNHQQTIYYKYANELDKFVTPKIQALKQAFQQQQKQLAQKGAASGTGVPPLRSPQGGD
EGLVGAKHPTFF
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atggcgccttcagagtgtcccagcgacgcgccgggggggtctggagagtcgcgagtttct
gcagaaccgagttcgtcagagacgccgtcctcagctgtctcttctcactctcctcatcgt
gctcagctcagttcaactcagccgaagaatccggcgtctcctccgacttcggacgtctct
gctcctcacgtccccctcctcggggccgaggcctccggcggcgatccttccgcagacccg
ctggggggcgagggcgcaatggagcgagagcgacaagcgtttgcggaggggccaggtctt
agtgcgagggtggagacagctctgtctcctcagctcagaacgacgagcggagagttgcag
caggctgcagccgacgcggctgtctcgcctgacggtgagaaggagaaagaagtagcgaat
tcgaggaagggagaggactcggggcgtctctcagctttcgtaggacgaggctcacgccgc
tcttcgcatgccgagcccgcagaggggccttcgctcccttccggagcggatgggcgcctc
ccggcctccgggccttgggcttctgaggcgccgcctgcgggccgcagtgcctccgcgccg
gtgccgccagtgtctccggggttcgctttcccgtcggtgacctcttgtttgccgctcaac
gcgagcattggagacattgccttgcggctggttaaagagattctccagccagtgctggcg
cgcgacatccaagtcgatccgccgtcgcccttccgattcacggcgagcggaatggcgaag
gccctcgaactgtctcctgtgtgcttctcgccggcgtacgcggcgtcgctccggaagtcc
tacgcccaaatgggaactgccggctcgtgcttctactgtgtctccgcgccctgcgtctgt
ggagcctttgcaccgccgctcgcccaggcgaggcccgcggagaacaagaagcgcggcaga
gacgcctgcgagggccctcaggcggagccccctgtggggcgaggcccgcggcgtggcccg
aacgactctggggcacctgtgggacaagacctgcctgggggtccgcaggcccctggaggc
ccggggggcggcttcggtgcagggcagacgtttcaggacaacttgcgccagatgtgcctc
ttccacccgtactcgagtgttcctccgccgaagctgattgacatgcggtacctctgtctc
tttctctcggcttctgcggactcgccctttgcctgcgccacgcggacgggcctctgtcct
ttcttcggggacggacccttcgggcccgacggcgagacccgcaacgggcgcgagggtccg
ctggcgcggagcggagacaaggtcgagggcgagaagaccttcttgtcgtttgttgacgaa
accgcagactttggtgatgcttcagtcgagaagggatttccggaccacgcacgcattggc
tgggaggtagtcgaggaggtcgcggagagtctcgaggctattttcaacactattcaaatg
gagacagttgaggaccgcagagatgccctcaccgtcccggacgagttctacgctcaaaac
tactgggagtggaggcagtttctgctcgacaaagccccaacaggagcctcggtgtcccga
acgttcgggcggagtctccttcgttctcttcttctcgcctcgccggggacgattgccaag
gacctgcaaagaactccgattagcttcgctgcaggcatcttgttctttcgtctttgcgag
gaagtcggcatcgaaccggaaacgcggcatgtcctctggcgcactgtggcttcttcccag
cctgaactgagatctcggctggtgagcgagagcggcctgggtttcctgtgtcgagacctg
gggtcggcgaaggaagaagaagcaggtctgatcaccttcaaatgcgtgacaaacgaccgg
caacctttctccagtcgcgcgctcgtgactgtgaaaaacatcttctctcgtcagcttccc
aagatgcccagagagtacattgtccgtctcgtctttgaccgaaaccactacaccttctgt
ctgaacaaggaagatacgatcatcggaggctgctgcttcagaccctacttccagcagaaa
ttcgccgaaatcgctttcctcgcggtaacgtcgaccgagcaggtgaagggctacggaacg
cgactgatgaatcacctgaaggagcacgtgaagaaatccggaatcgagtacttcttgacc
tacgcagacaactttgcagtcggttatttcagaaaacaaggattcacgcagaagatttca
atgccgcgagagcggtggtacggctacatcaaggactacgaaggcgggactctgatggaa
tgtcacatcaatccgcgcatcaattacctccgtctgtcggagatgctgcatgatcagcag
caggttatcaaacgcgccactgtttcccttaagcctcttgctgtctaccccggtctcgat
ttctggaagaagaatccagggcagacgctgtcgccgtcgcagattccaggtcttctgcag
tgcgggtggcacccgggggagggcgcgccgcgagcgggcgccgacgggaaggggatctcc
gaggccgagcgggccttcttgggctccacgggcgcgccggacggggctggaagcgcgggc
gttggccagggctacatgcgcccgctgcacgagcagatcatggacattctggatgcactg
gggaagcaccactccgcctggccgttcctcaaacctgtgagtcgcgaagaggctcccgac
tactacgacgtgattcttcagccgacagacatctcgacgatgaagaaaaaatgcaagaag
aagcactacacgactgcgcagatgtttgcggacgaagttcagttgatgttcaagaactgt
cggcagtacaaccaccagcaaacgatttattacaaatacgcgaacgagctggacaagttc
gtaactccaaagattcaggcgttgaagcaggcgttccagcagcagcagaagcaactggcg
caaaagggtgcggcgtcggggactggagtgccaccgctgaggagtccccagggtggagac
gaggggcttgtgggcgcgaagcatccgacatttttctag

DBGET integrated database retrieval system