KEGG   Toxoplasma gondii: TGME49_047240Help
Entry
TGME49_047240     CDS       T01093                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L5, putative (EC:3.4.19.12)
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
tgo  Toxoplasma gondii
Brite
Enzymes [BR:tgo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TGME49_047240
Peptidases [BR:tgo01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   TGME49_047240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 407 aa AA seqDB search
MGAEDGSSGANARNADGSNRWCLIESDPGVFTELVEKVGVKGVEFDEIFGVDEESFEALK
QRHRKIFGFVFLFNWTKDAAGAATGDAADSSQDVAMDDALGAAQCPPDLFFAKQVIENAC
ASQAILSVLVNKREEIQDVGSTINALVDFTKDFVDPQMRGEAIGNSELIRAAHNSFRSSS
PFDWTDDDDDKEKEDAFHFVSYIFFKGHAYEMDGLKPGPQNLGSCGEDSWTELVRKRLQS
RIAKIQTAASGELRFNLMAVTEDNLSKVQQDLLRERVVIQRAKIKLISSGQDIELDDEVD
DDQAPSGTPTMEELPDDIAALEKVVREAEDRKKLLKEQEEEELDKRARWKKENARRRHDF
VPFLLTVIKHLARKGELVKSVTAAQETIARRQHERKKAKTGATGVST
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccgaagacgggagcagcggcgcaaatgcgcggaacgcagacggcagcaatcgg
tggtgtttgatcgaaagtgacccgggcgtcttcacggagctcgtggagaaggtgggggtg
aaaggcgtggagttcgacgagattttcggcgtcgatgaggagtcgttcgaggcactgaaa
cagaggcatcgaaagatcttcggcttcgttttcctcttcaactggaccaaggatgctgcg
ggagcggcgactggagatgcagctgactcgagccaagacgtagccatggacgatgccctc
ggtgctgctcagtgtccaccagacctcttcttcgcgaaacaggtaatcgagaacgcatgc
gcgagccaggcgatcttgtccgttcttgtcaacaaacgagaagaaatccaagatgtcgga
tcgacaatcaatgcccttgttgacttcaccaaggactttgtcgatcctcaaatgcgtgga
gaggccataggcaactcggaactcattcgagctgcgcacaactctttcagaagctccagt
ccgttcgactggacagacgacgacgatgacaaggagaaggaggacgccttccactttgtg
tcgtacatctttttcaaaggccatgcgtacgaaatggacggcctgaagcccggtccccaa
aatttgggttcctgcggtgaggatagctggacggaacttgtcaggaagcggctgcaaagc
agaattgccaagattcagacggccgcaagtggagagctgcgtttcaacctgatggctgtg
acggaagacaatttgtcgaaagtgcagcaagacctgttgcgcgagagggtggttattcag
cgggcaaagatcaagctgattagttctggccaggacatcgaactggacgatgaggtggac
gacgaccaagcgccttcagggacgcccacgatggaggaactccccgacgacatcgccgct
ctggaaaaagttgttcgggaagcggaggacagaaagaagctgctgaaagagcaggaagaa
gaagaactggacaaacgagctcgatggaagaaggagaatgcccggcgacgtcacgacttc
gttcccttccttctgaccgtcatcaagcatctcgcgagaaagggggaactggtcaaatcc
gtcacggcagcacaggagacgatcgcgaggcggcagcacgagaggaaaaaggcgaaaacg
ggtgccacgggtgtctctacataa

DBGET integrated database retrieval system