KEGG   Toxoplasma gondii: TGME49_049180Help
Entry
TGME49_049180     CDS       T01093                                 

Definition
bifunctional dihydrofolate reductase / thymidylate synthase (EC:1.5.1.3 2.1.1.45)
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
tgo  Toxoplasma gondii
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tgo00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tgo00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:tgo00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 610 aa AA seqDB search
MQKPVCLVVAMTPKRGIGINNGLPWPHLTTDFKHFSRVTKTTPEEASRLNGWLPRKFAKT
GDSGLPSPSVGKRFNAVVMGRKTWESMPRKFRPLVDRLNIVVSSSLKEEDIAAEKPQAEG
QQRVRVCASLPAALSLLEEEYKDSVDQIFVVGGAGLYEAALSLGVASHLYITRVAREFPC
DVFFPAFPGDDILSNKSTAAQAAAPAESVFVPFCPELGREKDNEATYRPIFISKTFSDNG
VPYDFVVLEKRRKTDDAATAEPSNAMSSLTSTRETTPVHGLQAPSSAAAIAPVLAWMDEE
DRKKREQKELIRAVPHVHFRGHEEFQYLDLIADIINNGRTMDDRTGVGVISKFGCTMRYS
LDQAFPLLTTKRVFWKGVLEELLWFIRGDTNANHLSEKGVKIWDKNVTREFLDSRNLPHR
EVGDIGPGYGFQWRHFGAAYKDMHTDYTGQGVDQLKNVIQMLRTNPTDRRMLMTAWNPAA
LDEMALPPCHLLCQFYVNDQKELSCIMYQRSCDVGLGVPFNIASYSLLTLMVAHVCNLKP
KEFIHFMGNTHVYTNHVEALKEQLRREPRPFPIVNILNKERIKEIDDFTAEDFEVVGYVP
HGRIQMEMAV
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaaccggtgtgtctggtcgtcgcgatgacccccaagaggggcatcggcatcaac
aacggcctcccgtggccccacttgaccacagatttcaaacacttttctcgtgtgacaaaa
acgacgcccgaagaagccagtcgcctgaacgggtggcttcccaggaaatttgcaaagacg
ggcgactctggacttccctctccatcagtcggcaagagattcaacgccgttgtcatggga
cggaaaacctgggaaagcatgcctcgaaagtttagacccctcgtggacagattgaacatc
gtcgtttcctcttccctcaaagaagaagacattgcggcggagaagcctcaagctgaaggc
cagcagcgcgtccgagtctgtgcttcactcccagcagctctcagccttctggaggaagag
tacaaggattctgtcgaccagatttttgtcgtgggaggagcgggattgtacgaggcagcg
ctgtctctgggcgttgcctctcacctgtacatcacgcgtgtagcccgcgagtttccgtgc
gacgttttcttccctgcgttccccggagatgacattctttcaaacaaatcaactgctgcg
caggctgcagctcctgccgagtctgtgttcgttcccttttgtccggagctcggaagagag
aaggacaatgaagcgacgtatcgacccatcttcatttccaagaccttctcagacaacggg
gtaccctacgactttgtggttctcgagaagagaaggaagactgacgacgcagccactgcg
gaaccgagcaacgcaatgagctccttgacgtccacgagggagacaactcccgtgcacggg
ttgcaggctccttcttcggccgcagccattgccccggtgttggcgtggatggacgaagaa
gaccggaaaaaacgcgagcaaaaggaactgattcgggccgttccgcatgttcactttaga
ggccatgaagaattccagtaccttgatctcattgccgacattattaacaatggaaggaca
atggatgaccgaacgggcgttggtgtcatctccaaattcggctgcactatgcgctactcg
ctggatcaggcctttccacttctcaccacaaagcgtgtgttctggaaaggggtcctcgag
gagttgctgtggttcattcgcggcgacacgaacgcaaaccatctttctgagaagggcgtg
aagatctgggacaagaatgtgacacgcgagttcctcgattcgcgcaatctcccccaccga
gaggtcggagacatcggcccgggctacggcttccagtggagacacttcggcgcggcatac
aaagacatgcacacagactacacaggtcagggcgtcgaccagctgaagaatgtgatccag
atgctgagaacgaatccaacagatcgtcgcatgctcatgactgcctggaatcctgcagcg
ctggacgaaatggcgctgccgccttgtcacttgttgtgccagttctacgtgaacgaccag
aaggagctgtcctgcatcatgtatcagcggtcgtgcgatgtcggcctcggcgtccccttc
aacatcgcttcctattcgcttttgacgctcatggttgcacacgtctgcaacctaaaacct
aaggagttcattcacttcatggggaacacgcatgtctacacgaaccatgtcgaggcttta
aaagagcagctgcggagagaaccgagaccgttccccattgtgaacatcctcaacaaggaa
cgcatcaaggaaatcgacgatttcaccgccgaggattttgaggtcgtgggctacgtcccg
cacggacgaatccagatggagatggctgtctag

DBGET integrated database retrieval system