KEGG   Toxoplasma gondii: TGME49_049270Help
Entry
TGME49_049270     CDS       T01093                                 

Definition
thioredoxin, putative (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
tgo  Toxoplasma gondii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TGME49_049270
Enzymes [BR:tgo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TGME49_049270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 428 aa AA seqDB search
MALAQTQHLALLLAVLSVLTGAQAGLYAPNGPVKVLSGQQFKEQVVGSNDLFIVEFYADW
CGHCQRFAPEFEKAAKALRGIVTLVAVSDQSAMGEYGVQGFPTVKAFVGRGGKPPKTFDY
NQGRDAASLIEFAVMHAGKLARARLAGKIDAGTDAKPSEKAGSPEKETSDVIELTDGNFN
QLVMKDDKSVWFVEFYAPWCGHCKALAPTWEEVATALKGKVKVGKVDATVEKVLASTYGI
RGFPTLKLFPAGEKSVGLVKDYEGARTTEALLKYAMEFFSVNVTTEQLLNESQFRKACGD
QLCVLAFLPHILDSKTEKRNEYLATLNRVVRASFHMPIAFFWSQGGDQYEFEEQLNLAFG
YPAVVAVHLSKGKYAIHRGDFSQESINTFLTQLLAGKAPISELPKNLKKLEESRAWDGKD
EELPKDEL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcacttgcacagacgcagcacctcgcgcttctcctcgctgtcctctcggtcctcact
ggcgctcaggctggactctacgcgcccaacggacctgtaaaggttctctctggtcaacag
ttcaaggaacaagtcgtcggctccaacgacctcttcatcgtcgagttctatgccgactgg
tgcggacactgccagcgctttgcgcctgaattcgagaaggcagcgaaggctcttcggggc
attgtcactctcgttgcggtctcagaccaatctgcaatgggagagtatggcgtccaaggc
ttccccactgtcaaggccttcgttggacgaggtggaaaacccccaaagacgttcgactac
aaccaaggaagagacgcggcgtctctcatcgaattcgcggtgatgcatgcagggaaactc
gcgagagctcgcctagcagggaaaatcgacgctggcaccgacgcgaaaccctctgaaaaa
gccggctcaccggagaaggagacctcagacgtcatcgagttgacagatggcaacttcaac
cagttggtcatgaaggacgacaaaagcgtctggttcgtcgagttctacgcgccctggtgt
ggtcactgcaaggccctcgcgccgacatgggaggaagttgcgacagcgctgaaaggcaaa
gtgaaagttggcaaggtagatgctacggtggaaaaagtcctcgcgagcacctacggcatt
cggggatttccgactttgaaactcttcccggcaggcgagaagagcgtcggcctcgtcaag
gactacgaaggcgctcggacgacggaggcgcttctcaaatacgccatggagttcttcagt
gtgaatgtgactacagagcagctgttgaacgagagtcagtttcgcaaagcctgcggagac
cagctctgcgtcctcgcctttctgccgcacatcctcgacagcaaaacggagaagagaaac
gagtacctcgcgaccttgaaccgagtcgtcagagcgtccttccacatgccgatcgccttc
ttttggtctcaaggaggagaccagtatgaatttgaagagcaactgaacctcgccttcggc
taccccgccgtcgtggctgtccatctgtcgaaggggaaatacgcgatccaccgtggagat
ttcagccaggaaagcattaacaccttcttgactcaactcctggcggggaaggcgccgatc
tcggagctccccaagaacctgaagaagctggaggagtcgcgtgcgtgggatggcaaagat
gaagaacttccgaaagatgaactttga

DBGET integrated database retrieval system