KEGG   Toxoplasma gondii: TGME49_051870Help
Entry
TGME49_051870     CDS       T01093                                 

Definition
histone H2B, putative
Orthology
K11252  
histone H2B
Organism
tgo  Toxoplasma gondii
Brite
Exosome [BR:tgo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TGME49_051870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 115 aa AA seqDB search
MVAKKSAKVAKSKDSGKKGKGKKRAESYSSYIFKVLKQVHPETGISKKSMMIMTSFIADT
FDKIATEAGKLCKYNKKDTLSSREIQTAVRLVLPGELAKHAVSEGTKAVTKYTGK
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtggccaagaagtccgcgaaagtcgccaagtccaaggactctggcaagaagggcaag
ggcaagaagagagcggagtcgtacagctcttacatcttcaaggtgttgaagcaggtgcac
cccgagactgggatcagcaagaagtcgatgatgatcatgacttctttcatcgctgatacc
ttcgacaaaattgccactgaggccggcaagctctgcaagtacaacaagaaggatactctg
tcctcccgagagatccagactgccgtccgtcttgtcctccctggcgaacttgccaagcac
gccgtctctgagggcaccaaggccgtcaccaagtacactggcaaataa

DBGET integrated database retrieval system