KEGG   Toxoplasma gondii: TGME49_052380Help
Entry
TGME49_052380     CDS       T01093                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
tgo  Toxoplasma gondii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TGME49_052380
Enzymes [BR:tgo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     TGME49_052380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1222 aa AA seqDB search
MPPPCVSAPSRRAGDDLPPQRKASRLSSLLLLFLLTLHPSPVAVESVSTRGGDSREAEES
RTEDGPVAEAQSGFVTLQEAEKGGRQAFNPSVYTPEKIRISRRGPIRFMFGSCNLQPIGG
EWQVAEEDRHMWSFITRQKPDLFALLGDNVYAHNFRHLGLANSIRWNWKNLSWSELTRRR
IEVARAFHRPSTLDEVRQAFHNQTSHRPYQEFLDTGVHVIGTYDDHDLGDDNPSRVHSLK
YEARDIVLDFFNVSKNSPRRSVFWDGAFSSHKIQLDDGFAFRVILLDVRFNRDPWASLPH
GDILGNQQWRWLKEELRKSKEEGDAVTFIASSIQVLPSPFVATEAWSIFPDARRRLLNLI
MSSGVQIPVLLSGDVHFAEMNRVLCRPLSIGGAAAPAKQTGGPGAALSVPAQCLSPSPWQ
QVALLLWRLDRQSEDAERHAAASDTLGVDVAFAGPSRPPEASLEFQENRSLTAWRSPGLL
ARLFPSLSFLSTFVFMNLFAPSAATTFSLFSASHPADEYLPVVQRPETRRKGRSGAQERD
KFRDAGDLEGRSGRRAGRERRGVELNEVTSSGLTHGVEETFLTAAAPARLAEWGLRRLFP
RTSTSRDDFYGERLVYTRRNVGDVQLVRNPLSLLRAGAADAERRNNKKAKKKEHEKKDTE
EATDPQAEEAEERKEQRGPASETGGFEEARAAYSELLSAVSCGEGDEERLSPSVLEKVGR
FFAGSPGRFHMLLSLYQQLLAVHDRPQRQEREKTKLNISPRKAWGACSQGEASALAHLSQ
RERDENAGLRRSVWCWGDEEEEKEKSGESDRAKTERGESESDTVEYGNRPNVPYPLLRND
SFFSLLLTVESLLHTSLQRLSRSVSSSSFSSSFSPSFSSSSSSSSSSVFPSSSWTEELAS
FCELSRSPSREAVGGMLRFLNRENVDLSGRDPSDALRKRRLLLWASVGRDETQQICSALA
AVLPTGEEPGEKQRGSTQENHLREEDMQETAQASGGSSRKAKRGSREEKVEREEEALRAL
SQVAWKSSMDEEKVAGKAEEAGEAEEAGEAEEAGEAGGASDRFADEGVSCRNVEEILSAR
AWISVQIFALPFGDLVLESFISPFAFAQSRRRLETELEEEMGEAADARRVRWICDPPEGP
DPTPVYVAVAVLLLLVLFAAFSTLILRALWSCCACAFACARQSAKSAERGEGENRLKTRG
EEEARARGSVALSTSVRRRRVV
NT seq 3669 nt NT seq  +upstreamnt  +downstreamnt
atgcccccgccctgcgtgtctgcgccttcgcggcgggcaggcgacgatttgcctccgcag
cggaaggcgagtcgcctctcttctcttctacttcttttccttctcactctgcacccttct
cccgtcgccgtcgagtctgtctcgactcgcggcggcgacagtcgcgaagcagaagagtca
agaactgaggatggcccggttgctgaagcgcagagcggattcgtcacactccaagaagcc
gaaaagggagggcgacaggccttcaatccgagtgtatatacacccgagaagatccgcatt
tcacgtcgcggtccgattcgcttcatgttcggctcctgcaacctccagcccattggaggc
gaatggcaagtcgccgaagaagatcggcacatgtggagcttcattactcgccagaagccg
gatctctttgcgcttcttggggacaacgtctacgctcacaacttccgtcacctgggactg
gcgaacagcattcgctggaactggaaaaatctctcttggtcggagttgacgcgcagaagg
atagaagtcgctcgcgcctttcaccgcccatccacactggacgaagtgcgacaagcgttt
cacaaccagacttcccatcgcccctaccaggagttcctggacacaggcgtccacgtcatt
ggaacgtacgacgaccacgatttgggcgatgacaatccctcaagagttcactctctcaaa
tacgaggcccgagacatcgtgcttgactttttcaacgtatcgaagaattcgcctcgccgt
tcagtcttctgggacggggccttctcttcacacaagattcaacttgacgacggatttgca
tttcgcgtcattcttctggatgttagattcaatcgagatccctgggcctcgttgcctcat
ggagatattctcggaaaccagcagtggcgctggctcaaggaggaactgcgaaaatcgaag
gaggaaggagacgctgtcaccttcatagcctccagcatccaggttctcccctctcccttc
gtcgcgacggaggcttggtctatttttcccgacgctcgccgcagactcttgaacctcatc
atgagttcaggtgtacagatacccgtcctgctctccggggatgtgcactttgctgagatg
aatcgtgtgctgtgtcggccgctgtccatcggtggcgccgccgccccagcgaagcagacg
ggagggccgggagcggcgctctcggtcccggcgcagtgtctctcaccttctccatggcag
caggtagctctgcttctctggcggctcgacagacagagcgaagacgcagaaaggcacgca
gcggcctcagacacacttggagtggacgtagcgtttgccggtccgtcgcgtccgccggag
gcatctctcgagttccaggaaaaccgttcgctgacggcatggcgaagtccgggactgttg
gcgcggttgtttccttctctctccttcctgtcgacgtttgttttcatgaacctctttgcg
ccctcggcggcgacgaccttctcgcttttctccgcctcccaccctgccgacgaatacctg
cctgtcgtgcagcgaccagagacccgccgaaagggcagaagcggagcccaggaaagagac
aagtttcgcgacgcaggcgacctcgagggaaggagcgggcggcgggcaggccgcgagcgg
cgaggagtggagttgaacgaggtgacttcgagtggcctgactcacggagtcgaagaaacc
ttcctcaccgctgcggctcctgctcgtctcgccgagtgggggctgaggaggctgttccct
cgcacttcgacctcgcgcgacgacttctacggcgaacggctcgtgtacactcggcgcaac
gtcggagacgtccaactcgtgaggaatccgctgtcgcttctccgagcaggcgcagcagac
gccgagaggaggaacaacaagaaggcgaagaagaaagagcacgagaagaaggacacagaa
gaagcgacagatccgcaagccgaggaagcggaagagaggaaagaacagagaggtccggcg
tcggagacaggaggcttcgaggaagcgcgagcggcgtactcggagctgctctctgcggtg
tcgtgtggggaaggcgacgaggagagactgtctccgtctgtgctggagaaagtgggcagg
ttcttcgcaggcagtcccgggcgcttccatatgcttctttcgctgtatcagcagttgctt
gcagtccacgaccgcccacagagacaagaacgggagaagacgaagctaaacatttcgcct
cgaaaggcctggggcgcatgcagtcagggcgaggcctccgccttggcacatctctcccaa
agagagagagatgaaaacgcgggactgcgccgctctgtctggtgctggggagacgaagaa
gaagagaaagaaaagtcaggagagagcgaccgcgcgaagacagaacgaggcgagtccgaa
agcgacaccgtggaatacggtaatcggcctaacgtcccctaccctctcctccggaacgac
tcttttttctctctcctcctcacagttgagtctctcctccacacctcgcttcaacgcctt
tcccgcagtgtctcgtcgtcttccttctcttcttccttctctccatccttctcttcttcc
tcgtcttcgtcttcgtcttccgtttttccttcttcctcttggacagaggaacttgcgtcg
ttttgtgagctgagtcgttcgccgtctcgggaagccgtgggcggcatgctacggttcttg
aatcgcgaaaacgtggatctttctggtcgagacccctccgacgcactcaggaaacgtcgg
ctgctgctctgggcctctgtcgggcgagacgagacgcagcagatctgctctgctctcgcc
gcagtcctcccgaccggggaagagcccggagagaagcaaagaggaagcacgcaagaaaac
cacctgcgcgaggaagacatgcaggaaacggcgcaagcatccgggggttcaagcagaaag
gcgaaacgtggcagcagagaggagaaagtcgagagagaggaagaagcgttgagagctctg
tcgcaagtggcgtggaagagttcgatggacgaagagaaggttgctgggaaggctgaggag
gctggagaggctgaggaggctggagaggctgaggaggctggagaggcgggaggcgcgagt
gatagatttgcggatgagggtgtttcctgtaggaatgtcgaagagattctttcagctcgg
gcgtggatcagcgtgcaaattttcgctctgcctttcggggacttggtcctggaatccttt
atctctccattcgccttcgcacagtcccgaaggcgtctcgagactgaactggaagaagag
atgggagaggccgcagacgcccggcgcgtccgatggatctgtgaccctccagaaggcccc
gatccgacgcccgtgtacgtagcagtcgccgtgcttcttcttcttgttctttttgccgcc
ttctccacgctgattctccgcgctctgtggtcttgctgcgcatgcgccttcgcttgtgcg
aggcagtcggctaaaagcgcggaaagaggggaaggagagaacaggttaaaaacgcgtgga
gaggaagaggcgagagcgcgcgggagtgtggcgctctcgacgtcggtaagaagacgaaga
gtcgtgtga

DBGET integrated database retrieval system