KEGG   Toxoplasma gondii: TGME49_053080Help
Entry
TGME49_053080     CDS       T01093                                 

Definition
replication protein A2, putative
Orthology
K10739  
replication factor A2
Organism
tgo  Toxoplasma gondii
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    TGME49_053080
   03420 Nucleotide excision repair
    TGME49_053080
   03430 Mismatch repair
    TGME49_053080
   03440 Homologous recombination
    TGME49_053080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 278 aa AA seqDB search
MDFGHDPGPEGARQFGGGLGGDFADQAPFGGAPGLDAFGGGFPQGDGGFLASADPTGAMF
GAGDFDGGGFLMHAGAGATQVGAMSGHQQNTFMPVKIGAVMNAFAEKPDDSAISLAPPPA
PPLHLLRIIGRVSRVSGHLADGSVDYAAGRACFELEDGTGVVDCEWLLGDDITPYKQKRV
ESTIRVNNYVRVYGQMSTLGQAVPMLRVHAVRPVTSAGELLFHEADCCSSFVKIKFFGQQ
LPDPLEAPPPGLRGPAASHGPAQKPSSSLSPSHGYGRR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggatttcggccatgatcccggtccggagggcgcgcgccagttcggcggaggcctggga
ggagattttgccgaccaggcgccgtttggaggagcacctggcttggatgcgttcggggga
ggatttccacaaggcgatggcggcttcctcgccagtgcagatccgaccggagcgatgttt
ggagcaggtgacttcgatggcggcggattcttgatgcatgcaggggcgggagctacgcag
gttggtgcgatgtccggccaccaacagaatacattcatgcccgtcaaaatcggcgcggtg
atgaatgcgttcgcagagaagccagacgactcggcgatttccctcgcgccgccgcctgcg
ccgccgctgcacctgctgcggatcatcggccgagtctcgcgggtgtctggacacctcgcc
gacggttccgtcgactacgctgcaggtcgcgcctgcttcgagctcgaggacggcaccggc
gtcgttgactgcgagtggctgctcggcgacgatattacgccctacaagcaaaagcgcgtg
gagtcgaccatccgcgtgaacaactacgttcgggtgtatggacagatgtcgaccttgggt
caagccgtaccgatgctgcgagtgcatgcagtgaggccagtcacgtccgcaggcgagctt
ctgttccacgaggcagactgttgcagctccttcgtcaaaatcaaatttttcggtcagcaa
ctccccgaccctctcgaggctcctccgccaggccttcggggccctgcagcctcccacggc
cctgcgcaaaaaccgtcatcttcgctttctccttcccatggatacggacgaagatag

DBGET integrated database retrieval system