KEGG   Toxoplasma gondii: TGME49_053430Help
Entry
TGME49_053430     CDS       T01093                                 

Definition
asparagine synthase, putative (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tgo  Toxoplasma gondii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TGME49_053430
Enzymes [BR:tgo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     TGME49_053430
Peptidases [BR:tgo01002]
 Cysteine Peptidases
  Family C44
   TGME49_053430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 588 aa AA seqDB search
MCGILAILMSSLSRDQLRQLALERSRLSVFYRGGLDQECMGKSLWLRHRGPDSNGVHVQE
YSTTLCNALAHERLAIVDPATGKQPLCDASGTFVCVANGEIYNHVELTKTLLPPEEVAKW
KTASDCQPLPSLFKFHGPSICDKLDGIFSFVISNGATGEFIAARDPLGVCSLYVGYASDG
SIWFASELKALTRDCEQVTVFPPGHFYLSTMNEGKGGFQRYYNPSWWGVDKPLPTYRCDL
GQLREALEAAVRKRLMCDVPFGLMLSGGVDSSIIAAIAAKEFQKMSATEKGSHIWTNQIH
AFSIGLKDGPDRKFAKMVADMLGTVHHEFTFELEEGLDALDDVIYMIETYDITTVRASVP
MYLLCRMIKSLGVKVVLTGEGADEVFGGYLYFHSAPNREAFHRELQNKLNLVHFYDCLRA
NKTSMAWGVEARVPFLDRGFLDFAMSIDPEDKMCTNGRMEKQILRDAFKGYLPDEVLYRQ
KEQFSDGVGYAWIDHLKSYAEKKVTDTMMRNAKLLFPTNTPVTKEGYLYRAIFAKHYNKG
SAARTVHTGPSIACSTAAALEWNEKFQECIDQSGRSVDVHQFHQGHRD
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatcctcgccattttgatgtccagtttgagccgagaccagttgcgacaactg
gctctcgagcgctcgcgcctgagcgtcttttaccgagggggattggatcaagagtgtatg
ggtaaaagtctgtggcttcgccaccgcggacccgactcgaatggcgtccatgtgcaagaa
tactccacgaccttgtgcaatgcactcgcccacgagcgcctggccatcgtcgatccggcg
actggaaagcagcctttgtgcgacgcgtctggcacatttgtctgcgtggcgaacggagaa
atctacaaccacgtcgaactcaccaagacattgcttcccccagaggaagttgccaagtgg
aaaacggccagcgactgccagcctctcccgtctctcttcaaattccacgggccgagcatt
tgcgacaaactcgacggaattttcagcttcgtcatcagcaatggcgccactggcgaattt
atcgctgcccgcgaccctctgggggtctgctcgctgtacgtcggctacgcgtcggacggg
agcatttggttcgcgagcgagttgaaggctttgacgagggactgcgagcaagtaacagtt
tttcctccggggcacttctatctctcgaccatgaacgaaggcaagggtggtttccagcga
tactacaacccatcttggtggggggtggacaagccgctgccgacctaccgctgcgacctg
ggccaactgcgagaggcgctggaagctgccgtccgcaagcgcctcatgtgcgatgtacct
ttcgggctgatgctgtctggcggggtcgactcgtccatcatcgctgcaattgccgccaaa
gaatttcagaaaatgtctgccaccgaaaaaggaagtcacatctggaccaaccagatccac
gcgttctccatcggcctcaaggacggccccgacagaaagttcgcgaaaatggttgcggat
atgctgggcactgtccaccacgaattcacattcgagctggaagaaggtctggatgctctc
gacgacgtgatctacatgatcgagacttacgatatcacgactgttcgcgcctcagtgccc
atgtatcttctctgtcggatgatcaagtctctgggtgtgaaggtcgtcctcaccggcgag
ggtgcagacgaagtctttggcggctacctctacttccacagtgctccaaacagggaggct
ttccaccgagagttgcagaacaagctcaatctggtgcacttctatgattgcttgcgcgcc
aacaagacatcgatggcctggggagtcgaggcccgtgtccccttcctcgatcggggcttc
ttggattttgccatgtccatcgaccccgaagacaagatgtgcacgaacgggcggatggaa
aaacagattcttcgagacgcattcaaagggtatctgcctgatgaagttctctaccgccaa
aaggagcagttctctgacggagtcgggtacgcgtggattgaccatctgaagagctatgca
gaaaaaaaagtaacggacaccatgatgcgcaatgcgaaattgctcttcccaaccaacact
ccggtgacaaaggagggatatctttaccgtgcgatttttgccaagcactacaacaaaggc
agcgcggcacgtacggttcatacaggcccgtcaatcgcctgctccacggccgctgcactt
gaatggaacgaaaaattccaggaatgtattgatcagtctggaaggtctgtcgatgtccac
caatttcatcaagggcatcgggattaa

DBGET integrated database retrieval system