KEGG   Toxoplasma gondii: TGME49_053780Help
Entry
TGME49_053780     CDS       T01093                                 

Definition
GTP cyclohydrolase I, putative (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tgo  Toxoplasma gondii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TGME49_053780
Enzymes [BR:tgo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     TGME49_053780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 563 aa AA seqDB search
MEKPFSDSASLSSQREAQSRRKLASYIQRARPRSPGVTRRISRGSSVDRGGGTGSISTCS
SGRDLSRHVPVSNDKPTLSTHELRKHDNPQVNAHFGSERHGFLHAGGRSVPPSHSRSSSE
ALRRPFSQTNRSINDGHDLRTLEGTHNTGRRTSRTLYAVGCTISGSCNIENNGCATDEDP
NQKLAPPDRSHVFRRAANGCSAHINPRRFRSDGVNSKEQLVATVSSPALRFRGELRTSCS
DGGGTGDEQSLDATRSDRNRARRRRGRRGKLSKRRNDSTSVTPLTEWSAETQHSEGQGGT
AMASYGVTPEAFRSTVCQASNAQHNRSGREFSSTLADVPAAAYVSKLPRIPRQSTDQGLG
EDKKNAIEEGVRMILRAMGEDVTRAGLRETPKRVAAAMEFFSRGYRADPKDVIRNALFSV
EEGHEDGQYLAGKQGMVTVGRIDISSLCEHHLLPFFGKCHIGYIPDKHVLGISKFARIME
IYSRRLQIQERLTQQIALAVMKVAKPRGVAVLLECTHMCMAMRGVSSPGSVTTTKAFLGV
FETDPALRSEFMSSIFRQAAAGT
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagccattcagtgactcagcaagtctctcatcgcagcgagaagctcagtcgcga
aggaaactggcttcgtatatccaaagggctcgtcctcgatcgcccggcgtcacacgtcgc
ataagtagaggaagcagcgttgatcggggtgggggaacgggtagcatcagcacgtgcagc
agcggccgagatttgagtcgacatgttcccgtttcgaatgacaagccgaccctctcaaca
catgaactgcgaaagcacgacaaccctcaggtaaatgcacactttggctcggaacgtcat
ggcttcctgcatgccggtggacggtcggttccgccgagccattctagatcgtcttccgag
gctttgcgcaggccattttctcaaaccaacaggtccatcaacgacgggcacgaccttaga
acccttgaagggactcataacaccggaaggcggacttcccggactctgtacgctgttggc
tgcaccataagcggcagctgcaatatcgaaaacaacggctgtgcgaccgatgaggatccg
aatcagaagttggcaccacccgaccgcagtcatgtgtttcgacgagcagcgaacggttgc
tccgcacacataaatccccggcgctttcgctcagacggtgtaaatagcaaggaacagctt
gtcgccacagtttcatcgccggcccttcgattcagaggtgaactccgaaccagctgcagt
gacggcggtggaacaggagacgagcagtctctcgatgctacgcgaagcgatcgaaatcga
gcacgacgcaggagggggagaagagggaaattatccaaacgaaggaatgattctacatca
gtaacacccttgacagaatggtctgcagaaacccagcacagtgaaggtcaaggtggtacc
gcgatggcgtcatacggggtgacacccgaggctttcaggtctacggtgtgtcaggccagc
aatgcccagcacaatagaagtggccgagaattcagttcgactcttgcagatgttcctgcg
gctgcgtacgtctcaaaactgcctcgcatcccacgccagtcaactgaccaaggtctcgga
gaagacaagaaaaacgcgattgaggaaggcgtccgtatgattctccgagccatgggcgaa
gacgtcactagggcaggcttgcgggagacaccgaagagagttgctgctgccatggagttt
ttctctcgaggataccgtgccgatccaaaagatgtcatacggaatgccctcttcagtgtg
gaagagggacacgaagacggccagtatctcgccggcaaacaagggatggtcactgtgggg
cgtatcgatatcagttctctgtgtgagcatcaccttctccctttcttcggcaaatgccac
attgggtacattcccgacaagcatgtgttgggcatttccaagttcgcgcgaataatggaa
atttactcgcgcagattacagatccaggagaggctaactcagcagatcgccctggcggtg
atgaaggttgcgaagcctcgcggagtcgccgtgttgctcgaatgcactcacatgtgcatg
gcgatgcgaggcgtttcgagtcctggaagcgtgacaacgactaaagccttccttggcgtg
ttcgaaacggatcctgccctgcggagcgagttcatgtcgtcgatttttcggcaggctgcc
gctgggacataa

DBGET integrated database retrieval system