KEGG   Toxoplasma gondii: TGME49_053900Help
Entry
TGME49_053900     CDS       T01093                                 

Definition
delta-aminolevulinic acid dehydratase, putative (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tgo  Toxoplasma gondii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tgo00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 658 aa AA seqDB search
MRPLSLFFRLSFLLFVLLFPSPSVDALLQSSSVAGSFPTPASVASSGRSVSPHNALYVHS
RTEATAGLPSGASLAITLNGESEEPRRNGARRKGSKSLGFLVAPPLSRSCTTEQTGELFS
GGAKVRGLNVQVTASPVGRELASSLRSRASEPEIRQLAASPIFGAPKPFSSCPCSSSSRS
SCAAHPSALLPEVCSFVSRRGARRNLGAQRGRGPGARGQRLGAAAGPTPVGKGTPGGAKG
QFRGGMSAQKGAVHQEPLRGRLEEDEEEEDEFEDDEFDDEDEGEDEGEDEEYDEEDDEDY
DPMTPRGPLDNNNYGEVWLPIQARPRRNRKNRAVRQLVQENLVKPSSLIYPLFVHDEETS
VPIPSMPGQSRLSMEDLLKEVGEARSYGIKAFMLFPKVDDELKSVMAEESYNPDGLLPRA
IMALKEAFPDVLLLADVALDPYSSMGHDGVVDEQSGKIVNDLTVHQLCKQAITLARAGAD
MVCPSDMMDGRVSAIRESLDMEGCTDTSILAYSCKYASSFYGPFRDALDSHMVGGTDKKT
YQMDPSNSREAEREAEADASEGADMLMVKPGLPYLDVLAKIREKSKLPMVAYHVSGEYAM
LKAAAEKGYISEKDTVLEVLKSFRRAGADAVATYYAKEAAKWMVEDMKGTQKFTEPCY
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcctctctcgcttttcttccgactttccttcctcttgttcgtccttctcttcccg
tctccctctgtcgacgcgctcctccagtcttcctcagtcgcgggttcctttcctacgcca
gcttcggtggcttcttccggtcgttctgtctcgccgcacaacgcgctgtacgtacactcc
aggactgaggcgactgcggggctgccctccggagcttctctcgctatcaccctgaatggg
gaaagcgaagaaccacgtagaaatggtgcaaggaggaagggatctaagtccctaggtttc
ctcgtcgcgcctcctctttcgcggagctgtaccacggagcagaccggagagcttttctcc
ggaggagcgaaggttcgcgggttaaatgtccaggtcactgcgtcgcccgtcggtcgcgaa
ctcgcttcttctctccggtcgcgtgcatcggaacctgaaattcgacaactcgctgcgtcg
ccgatcttcggtgctcccaagccgttctcttcctgtccgtgttcgtcctcgtctcgttcc
tcttgtgctgcgcatcctagtgcgctgctgcctgaggtctgttccttcgtgtctcgccgc
ggagcccgaagaaatctcggagcccaacgcggtcgcgggcctggggcgcggggccagcgc
ctcggggccgcggcgggtccgacgccggtggggaagggaacacccggcggggcgaagggt
cagttcagaggcgggatgagtgcgcagaagggagcggtgcatcaagagccgctccgaggc
cgccttgaggaagacgaagaggaagaggacgagttcgaagacgatgagttcgatgacgaa
gacgagggcgaagacgagggcgaagacgaggaatacgatgaggaggatgatgaggactac
gatccgatgacgccacgggggcccctcgacaacaacaactacggcgaggtctggcttccc
attcaagcacgccctcgaagaaaccggaaaaaccgcgccgttcgccaactcgtccaggaa
aacctcgtcaaaccttcgagtctcatctatcctctttttgtccacgacgaagaaacgagt
gtgccgattccctcgatgcctggccaaagtcgtctgagcatggaagatctgttgaaggag
gtgggcgaggcccgaagctacggcatcaaagcgttcatgctcttcccgaaagtcgatgac
gaactcaaatcagtcatggccgaagaaagctacaatccggacggcctcttgcctcgcgcc
ataatggctctgaaggaagctttcccagatgtccttctcctggcagatgtggctcttgac
ccatacagctctatgggtcacgatggcgttgtcgatgaacaaagcggaaagatcgtaaac
gatcttactgttcaccagctgtgcaaacaggcgattacgcttgcgcgcgcaggggcagat
atggtgtgtccgagtgatatgatggacggacgtgtgtcggcgattcgggagtctctcgac
atggaaggttgcacagacaccagcattctcgcctactcctgcaaatacgcctcctcgttc
tatggcccgttccgcgatgctctggactcacacatggttggcggcacagacaagaaaaca
tatcagatggacccgtcgaactcccgcgaagcagagagagaagccgaagcagacgcctct
gaaggcgcggacatgctgatggtgaagccggggctcccgtatctggatgtattggcaaag
attcgcgagaagtcgaaactgcccatggtggcttaccacgtttcgggagaatatgctatg
ctcaaagccgcggcggagaagggctacatcagtgagaaggatacggtcctggaagtcctc
aagagcttccgacgcgcgggtgcagacgccgtggccacctactacgccaaagaggcggcc
aaatggatggtcgaggacatgaaaggaacgcagaagtttacagaaccctgctactaa

DBGET integrated database retrieval system